Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   NWE25_RS12050 Genome accession   NZ_CP102866
Coordinates   2539843..2540157 (-) Length   104 a.a.
NCBI ID   WP_038459179.1    Uniprot ID   -
Organism   Bacillus velezensis strain YS-AT-DS1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2534843..2545157
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NWE25_RS12005 (NWE25_12005) sinI 2535524..2535697 (+) 174 WP_007612543.1 anti-repressor SinI Regulator
  NWE25_RS12010 (NWE25_12010) sinR 2535731..2536066 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NWE25_RS12015 (NWE25_12015) tasA 2536114..2536899 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  NWE25_RS12020 (NWE25_12020) sipW 2536964..2537548 (-) 585 WP_012117977.1 signal peptidase I SipW -
  NWE25_RS12025 (NWE25_12025) tapA 2537520..2538191 (-) 672 WP_038459173.1 amyloid fiber anchoring/assembly protein TapA -
  NWE25_RS12030 (NWE25_12030) - 2538450..2538779 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  NWE25_RS12035 (NWE25_12035) - 2538820..2538999 (-) 180 WP_022552966.1 YqzE family protein -
  NWE25_RS12040 (NWE25_12040) comGG 2539056..2539433 (-) 378 WP_038459177.1 competence type IV pilus minor pilin ComGG Machinery gene
  NWE25_RS12045 (NWE25_12045) comGF 2539434..2539934 (-) 501 WP_228842201.1 competence type IV pilus minor pilin ComGF -
  NWE25_RS12050 (NWE25_12050) comGE 2539843..2540157 (-) 315 WP_038459179.1 competence type IV pilus minor pilin ComGE Machinery gene
  NWE25_RS12055 (NWE25_12055) comGD 2540141..2540578 (-) 438 WP_038459181.1 competence type IV pilus minor pilin ComGD Machinery gene
  NWE25_RS12060 (NWE25_12060) comGC 2540568..2540876 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  NWE25_RS12065 (NWE25_12065) comGB 2540881..2541918 (-) 1038 WP_038459183.1 competence type IV pilus assembly protein ComGB Machinery gene
  NWE25_RS12070 (NWE25_12070) comGA 2541905..2542975 (-) 1071 WP_038459186.1 competence type IV pilus ATPase ComGA Machinery gene
  NWE25_RS12075 (NWE25_12075) - 2543172..2544122 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11932.91 Da        Isoelectric Point: 5.8321

>NTDB_id=719426 NWE25_RS12050 WP_038459179.1 2539843..2540157(-) (comGE) [Bacillus velezensis strain YS-AT-DS1]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRSEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=719426 NWE25_RS12050 WP_038459179.1 2539843..2540157(-) (comGE) [Bacillus velezensis strain YS-AT-DS1]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCAGCGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481