Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NWE25_RS12005 Genome accession   NZ_CP102866
Coordinates   2535524..2535697 (+) Length   57 a.a.
NCBI ID   WP_007612543.1    Uniprot ID   -
Organism   Bacillus velezensis strain YS-AT-DS1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2530524..2540697
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NWE25_RS11990 (NWE25_11990) gcvT 2531337..2532437 (-) 1101 WP_038459167.1 glycine cleavage system aminomethyltransferase GcvT -
  NWE25_RS11995 (NWE25_11995) - 2532861..2534531 (+) 1671 WP_038459170.1 DEAD/DEAH box helicase -
  NWE25_RS12000 (NWE25_12000) - 2534553..2535347 (+) 795 WP_007612541.1 YqhG family protein -
  NWE25_RS12005 (NWE25_12005) sinI 2535524..2535697 (+) 174 WP_007612543.1 anti-repressor SinI Regulator
  NWE25_RS12010 (NWE25_12010) sinR 2535731..2536066 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NWE25_RS12015 (NWE25_12015) tasA 2536114..2536899 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  NWE25_RS12020 (NWE25_12020) sipW 2536964..2537548 (-) 585 WP_012117977.1 signal peptidase I SipW -
  NWE25_RS12025 (NWE25_12025) tapA 2537520..2538191 (-) 672 WP_038459173.1 amyloid fiber anchoring/assembly protein TapA -
  NWE25_RS12030 (NWE25_12030) - 2538450..2538779 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  NWE25_RS12035 (NWE25_12035) - 2538820..2538999 (-) 180 WP_022552966.1 YqzE family protein -
  NWE25_RS12040 (NWE25_12040) comGG 2539056..2539433 (-) 378 WP_038459177.1 competence type IV pilus minor pilin ComGG Machinery gene
  NWE25_RS12045 (NWE25_12045) comGF 2539434..2539934 (-) 501 WP_228842201.1 competence type IV pilus minor pilin ComGF -
  NWE25_RS12050 (NWE25_12050) comGE 2539843..2540157 (-) 315 WP_038459179.1 competence type IV pilus minor pilin ComGE Machinery gene
  NWE25_RS12055 (NWE25_12055) comGD 2540141..2540578 (-) 438 WP_038459181.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6672.68 Da        Isoelectric Point: 9.8168

>NTDB_id=719423 NWE25_RS12005 WP_007612543.1 2535524..2535697(+) (sinI) [Bacillus velezensis strain YS-AT-DS1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=719423 NWE25_RS12005 WP_007612543.1 2535524..2535697(+) (sinI) [Bacillus velezensis strain YS-AT-DS1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719