Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   NV349_RS23060 Genome accession   NZ_CP102798
Coordinates   4693148..4693720 (-) Length   190 a.a.
NCBI ID   WP_058844074.1    Uniprot ID   -
Organism   Lysinibacillus sp. OF-1     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4662137..4702406 4693148..4693720 within 0


Gene organization within MGE regions


Location: 4662137..4702406
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NV349_RS22905 (NV349_22920) queE 4662137..4662865 (-) 729 WP_271911940.1 7-carboxy-7-deazaguanine synthase QueE -
  NV349_RS22910 (NV349_22925) queD 4662858..4663331 (-) 474 WP_036119403.1 6-carboxytetrahydropterin synthase QueD -
  NV349_RS22915 (NV349_22930) queC 4663335..4663994 (-) 660 WP_271911943.1 7-cyano-7-deazaguanine synthase QueC -
  NV349_RS22920 (NV349_22935) queF 4664114..4664614 (-) 501 WP_271911944.1 preQ(1) synthase -
  NV349_RS22925 (NV349_22940) - 4664952..4666514 (-) 1563 WP_271911946.1 recombinase family protein -
  NV349_RS22930 (NV349_22945) - 4666684..4667460 (-) 777 WP_271913650.1 recombinase family protein -
  NV349_RS22935 (NV349_22950) - 4667738..4668592 (-) 855 WP_271911947.1 RNA replicase -
  NV349_RS22940 (NV349_22955) - 4669492..4669659 (-) 168 WP_205445382.1 hypothetical protein -
  NV349_RS22945 (NV349_22960) - 4669809..4670222 (-) 414 WP_271911949.1 hypothetical protein -
  NV349_RS22950 (NV349_22965) - 4670368..4670592 (+) 225 WP_271911950.1 helix-turn-helix transcriptional regulator -
  NV349_RS22955 (NV349_22970) - 4670649..4671776 (-) 1128 WP_271911952.1 protein kinase family protein -
  NV349_RS22960 (NV349_22975) - 4672035..4672688 (-) 654 WP_271911953.1 hypothetical protein -
  NV349_RS22965 (NV349_22980) rlmH 4673250..4673729 (-) 480 WP_036119387.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  NV349_RS22970 (NV349_22985) - 4673820..4673984 (-) 165 WP_271911954.1 CxxH/CxxC protein -
  NV349_RS22975 (NV349_22990) - 4674229..4675527 (-) 1299 WP_036119381.1 trypsin-like peptidase domain-containing protein -
  NV349_RS22980 (NV349_22995) - 4675694..4676482 (-) 789 WP_036119378.1 MBL fold metallo-hydrolase -
  NV349_RS22985 (NV349_23000) yycI 4676482..4677303 (-) 822 WP_271911957.1 two-component system regulatory protein YycI -
  NV349_RS22990 (NV349_23005) yycH 4677290..4678615 (-) 1326 WP_271911960.1 two-component system activity regulator YycH -
  NV349_RS22995 (NV349_23010) walK 4678612..4680477 (-) 1866 WP_058844079.1 cell wall metabolism sensor histidine kinase WalK -
  NV349_RS23000 (NV349_23015) yycF 4680483..4681196 (-) 714 WP_036077923.1 response regulator YycF -
  NV349_RS23005 (NV349_23020) - 4681411..4682874 (-) 1464 WP_058844077.1 M23 family metallopeptidase -
  NV349_RS23010 (NV349_23025) - 4683278..4684141 (+) 864 WP_051891596.1 YitT family protein -
  NV349_RS23015 (NV349_23030) - 4684191..4685480 (-) 1290 WP_036119360.1 adenylosuccinate synthase -
  NV349_RS23020 (NV349_23035) dnaB 4685717..4687078 (-) 1362 WP_036119357.1 replicative DNA helicase -
  NV349_RS23025 (NV349_23040) rplI 4687092..4687538 (-) 447 WP_036119355.1 50S ribosomal protein L9 -
  NV349_RS23030 (NV349_23045) - 4687538..4689508 (-) 1971 WP_271911967.1 DHH family phosphoesterase -
  NV349_RS23035 (NV349_23050) - 4689522..4690463 (-) 942 WP_271911969.1 YybS family protein -
  NV349_RS23040 (NV349_23055) - 4690883..4690987 (-) 105 Protein_4450 30S ribosomal protein S18 -
  NV349_RS23045 (NV349_23060) - 4691356..4692054 (+) 699 WP_271911971.1 hypothetical protein -
  NV349_RS23050 (NV349_23065) - 4692064..4692261 (+) 198 WP_036119346.1 hypothetical protein -
  NV349_RS23055 (NV349_23070) rpsR 4692872..4693108 (-) 237 WP_004233359.1 30S ribosomal protein S18 -
  NV349_RS23060 (NV349_23075) ssbA 4693148..4693720 (-) 573 WP_058844074.1 single-stranded DNA-binding protein Machinery gene
  NV349_RS23065 (NV349_23080) rpsF 4693764..4694051 (-) 288 WP_036119511.1 30S ribosomal protein S6 -
  NV349_RS23070 (NV349_23085) - 4694218..4694793 (+) 576 WP_271911976.1 DUF3267 domain-containing protein -
  NV349_RS23075 (NV349_23090) - 4694849..4695889 (-) 1041 WP_271911978.1 acyl-CoA dehydrogenase -
  NV349_RS23080 (NV349_23095) ychF 4695974..4697074 (-) 1101 WP_036119519.1 redox-regulated ATPase YchF -
  NV349_RS23085 (NV349_23100) - 4697174..4697374 (-) 201 WP_036119522.1 DUF951 domain-containing protein -
  NV349_RS23090 (NV349_23105) - 4697374..4698246 (-) 873 WP_036119525.1 mechanosensitive ion channel family protein -
  NV349_RS23095 (NV349_23110) yyaC 4698338..4698970 (+) 633 WP_036119529.1 spore protease YyaC -
  NV349_RS23100 (NV349_23115) - 4698887..4699603 (-) 717 WP_036119532.1 DUF554 domain-containing protein -
  NV349_RS23105 (NV349_23120) - 4699681..4700529 (-) 849 WP_271911979.1 ParB/RepB/Spo0J family partition protein -
  NV349_RS23110 (NV349_23125) - 4700522..4701283 (-) 762 WP_036119537.1 AAA family ATPase -
  NV349_RS23115 (NV349_23130) noc 4701504..4702406 (-) 903 WP_036119540.1 nucleoid occlusion protein -

Sequence

Protein


Download         Length: 190 a.a.        Molecular weight: 20619.61 Da        Isoelectric Point: 4.7719

>NTDB_id=719097 NV349_RS23060 WP_058844074.1 4693148..4693720(-) (ssbA) [Lysinibacillus sp. OF-1]
MINRVVLVGRLTKDPELRYTPNGIASTRFTVAVNRAFSNQQGEREADFISCVAWRKQAENLANFMRKGSLIGVEGRIQTG
SYEGQDGKRVYTTDVVADSVQFLEPRNGSGAPAPQYGGGQTYGNNQPSYGGGQPQQQFGGGAMPGQGSYGGDAYQQNQPP
MNQPNYTRVDEDPFANSKGPIEVSEDDLPF

Nucleotide


Download         Length: 573 bp        

>NTDB_id=719097 NV349_RS23060 WP_058844074.1 4693148..4693720(-) (ssbA) [Lysinibacillus sp. OF-1]
ATGATAAACCGTGTCGTATTAGTCGGAAGACTAACAAAAGATCCTGAGCTACGTTATACACCAAATGGAATTGCGTCTAC
AAGATTTACAGTTGCTGTAAACCGTGCATTCTCAAATCAACAAGGTGAACGCGAAGCTGATTTCATTAGCTGTGTTGCAT
GGCGAAAACAGGCTGAAAACCTAGCGAACTTCATGCGAAAAGGAAGTTTAATTGGGGTAGAGGGCCGTATTCAAACAGGC
AGTTATGAAGGACAAGACGGTAAGCGAGTATACACAACAGATGTCGTGGCAGATAGCGTACAGTTTTTAGAACCCCGTAA
TGGTAGCGGTGCACCTGCTCCTCAATACGGTGGTGGACAAACTTACGGTAATAACCAACCGTCATATGGCGGTGGTCAAC
CACAACAACAGTTTGGTGGCGGCGCAATGCCAGGACAGGGTTCCTATGGCGGCGATGCTTATCAGCAAAATCAACCACCT
ATGAATCAGCCGAATTATACACGTGTAGATGAGGACCCATTTGCGAATAGCAAAGGGCCAATAGAAGTATCTGAGGATGA
TCTTCCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

54.211

100

0.542
  ssb Latilactobacillus sakei subsp. sakei 23K

47.368

100

0.474