Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NUW85_RS00245 Genome accession   NZ_CP102603
Coordinates   35007..35180 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain MBLB0692     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 30007..40180
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NUW85_RS00195 (NUW85_00195) comGD 30128..30565 (+) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  NUW85_RS00200 (NUW85_00200) comGE 30549..30863 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  NUW85_RS00205 (NUW85_00205) comGF 30877..31272 (+) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  NUW85_RS00210 (NUW85_00210) comGG 31273..31650 (+) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  NUW85_RS00215 (NUW85_00215) - 31707..31886 (+) 180 WP_003153093.1 YqzE family protein -
  NUW85_RS00220 (NUW85_00220) - 31926..32255 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  NUW85_RS00225 (NUW85_00225) tapA 32514..33185 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  NUW85_RS00230 (NUW85_00230) - 33157..33741 (+) 585 WP_012117977.1 signal peptidase I -
  NUW85_RS00235 (NUW85_00235) - 33805..34590 (+) 786 WP_003153102.1 TasA family protein -
  NUW85_RS00240 (NUW85_00240) sinR 34638..34973 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NUW85_RS00245 (NUW85_00245) sinI 35007..35180 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  NUW85_RS00250 (NUW85_00250) - 35357..36151 (-) 795 WP_014305407.1 YqhG family protein -
  NUW85_RS00255 (NUW85_00255) - 36169..37839 (-) 1671 WP_139885316.1 SNF2-related protein -
  NUW85_RS00260 (NUW85_00260) gcvT 38262..39362 (+) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=718011 NUW85_RS00245 WP_003153105.1 35007..35180(-) (sinI) [Bacillus amyloliquefaciens strain MBLB0692]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=718011 NUW85_RS00245 WP_003153105.1 35007..35180(-) (sinI) [Bacillus amyloliquefaciens strain MBLB0692]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702