Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | JMUB1273_RS10265 | Genome accession | NZ_AP018922 |
| Coordinates | 1999915..2000358 (-) | Length | 147 a.a. |
| NCBI ID | WP_001099009.1 | Uniprot ID | A0A0C6EXF8 |
| Organism | Staphylococcus aureus strain JMUB1273 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1967684..2020535 | 1999915..2000358 | within | 0 |
Gene organization within MGE regions
Location: 1967684..2020535
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMUB1273_RS10015 (JMUB1273_1865) | scn | 1967684..1968034 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| JMUB1273_RS10020 (JMUB1273_1866) | - | 1968544..1968882 (-) | 339 | Protein_1861 | SH3 domain-containing protein | - |
| JMUB1273_RS10035 (JMUB1273_1867) | sak | 1969531..1970022 (-) | 492 | WP_000920041.1 | staphylokinase | - |
| JMUB1273_RS10040 (JMUB1273_1868) | - | 1970213..1970968 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| JMUB1273_RS10045 (JMUB1273_1869) | - | 1970980..1971234 (-) | 255 | WP_000611512.1 | phage holin | - |
| JMUB1273_RS10050 | - | 1971286..1971393 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| JMUB1273_RS10055 (JMUB1273_1870) | pepG1 | 1971446..1971580 (-) | 135 | WP_000880502.1 | type I toxin-antitoxin system toxin PepG1 | - |
| JMUB1273_RS10060 (JMUB1273_1871) | - | 1971765..1972139 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| JMUB1273_RS10065 (JMUB1273_1872) | - | 1972195..1972482 (-) | 288 | WP_001262620.1 | hypothetical protein | - |
| JMUB1273_RS10070 (JMUB1273_1873) | - | 1972528..1972680 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| JMUB1273_RS10075 (JMUB1273_1874) | - | 1972673..1976455 (-) | 3783 | WP_119267461.1 | phage tail spike protein | - |
| JMUB1273_RS10080 (JMUB1273_1875) | - | 1976471..1977955 (-) | 1485 | WP_117216375.1 | phage distal tail protein | - |
| JMUB1273_RS10085 (JMUB1273_1876) | - | 1977952..1982481 (-) | 4530 | WP_117216377.1 | phage tail tape measure protein | - |
| JMUB1273_RS14150 (JMUB1273_1877) | gpGT | 1982538..1982675 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| JMUB1273_RS10090 (JMUB1273_1878) | gpG | 1982726..1983076 (-) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| JMUB1273_RS10095 (JMUB1273_1879) | - | 1983126..1983356 (-) | 231 | Protein_1875 | Ig-like domain-containing protein | - |
| JMUB1273_RS10100 (JMUB1273_1880) | - | 1983392..1984036 (-) | 645 | WP_000268740.1 | major tail protein | - |
| JMUB1273_RS10105 (JMUB1273_1881) | - | 1984037..1984444 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| JMUB1273_RS10110 (JMUB1273_1882) | - | 1984441..1984845 (-) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| JMUB1273_RS10115 (JMUB1273_1883) | - | 1984842..1985204 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| JMUB1273_RS10120 (JMUB1273_1884) | - | 1985188..1985472 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| JMUB1273_RS10125 (JMUB1273_1885) | - | 1985462..1985746 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| JMUB1273_RS10130 (JMUB1273_1886) | - | 1985766..1986911 (-) | 1146 | WP_117207573.1 | phage major capsid protein | - |
| JMUB1273_RS10135 (JMUB1273_1887) | - | 1986935..1987672 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| JMUB1273_RS10140 (JMUB1273_1888) | - | 1987656..1988843 (-) | 1188 | WP_117207574.1 | phage portal protein | - |
| JMUB1273_RS10145 (JMUB1273_1889) | - | 1988859..1990520 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| JMUB1273_RS10150 (JMUB1273_1890) | - | 1990517..1990861 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| JMUB1273_RS10155 (JMUB1273_1891) | - | 1990992..1991291 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| JMUB1273_RS10160 (JMUB1273_1892) | - | 1991523..1991939 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| JMUB1273_RS10165 (JMUB1273_1893) | - | 1991967..1992167 (-) | 201 | WP_001794311.1 | DUF1514 family protein | - |
| JMUB1273_RS10170 (JMUB1273_1894) | - | 1992167..1992817 (-) | 651 | WP_001005262.1 | hypothetical protein | - |
| JMUB1273_RS10175 (JMUB1273_1896) | rinB | 1992976..1993125 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| JMUB1273_RS10180 (JMUB1273_1897) | - | 1993122..1993328 (-) | 207 | WP_000195810.1 | DUF1381 domain-containing protein | - |
| JMUB1273_RS10185 (JMUB1273_1898) | - | 1993365..1993892 (-) | 528 | WP_117216380.1 | dUTPase | - |
| JMUB1273_RS14155 (JMUB1273_1899) | - | 1993907..1994068 (-) | 162 | WP_172571785.1 | hypothetical protein | - |
| JMUB1273_RS10190 (JMUB1273_1900) | - | 1994069..1994350 (-) | 282 | WP_000454994.1 | hypothetical protein | - |
| JMUB1273_RS14160 (JMUB1273_1901) | - | 1994351..1994524 (-) | 174 | WP_000028424.1 | hypothetical protein | - |
| JMUB1273_RS10195 (JMUB1273_1902) | - | 1994514..1994765 (-) | 252 | WP_001065074.1 | DUF1024 family protein | - |
| JMUB1273_RS10200 (JMUB1273_1903) | - | 1994779..1995027 (-) | 249 | WP_117216382.1 | SAV1978 family virulence-associated passenger protein | - |
| JMUB1273_RS10205 (JMUB1273_1904) | - | 1995036..1995236 (-) | 201 | WP_000235326.1 | hypothetical protein | - |
| JMUB1273_RS10210 (JMUB1273_1905) | - | 1995239..1995496 (-) | 258 | WP_000022720.1 | DUF3310 domain-containing protein | - |
| JMUB1273_RS10215 (JMUB1273_1906) | - | 1995496..1995867 (-) | 372 | WP_115282698.1 | SA1788 family PVL leukocidin-associated protein | - |
| JMUB1273_RS10220 (JMUB1273_1907) | - | 1995868..1996053 (-) | 186 | WP_001187242.1 | DUF3113 family protein | - |
| JMUB1273_RS10225 (JMUB1273_1908) | - | 1996058..1996462 (-) | 405 | WP_000049784.1 | DUF1064 domain-containing protein | - |
| JMUB1273_RS10235 (JMUB1273_1909) | - | 1996473..1996696 (-) | 224 | Protein_1904 | DUF3269 family protein | - |
| JMUB1273_RS10240 (JMUB1273_1910) | - | 1996709..1996867 (-) | 159 | WP_015997089.1 | hypothetical protein | - |
| JMUB1273_RS10245 (JMUB1273_1911) | - | 1996861..1997634 (-) | 774 | WP_117216985.1 | ATP-binding protein | - |
| JMUB1273_RS10250 (JMUB1273_1912) | - | 1997644..1998414 (-) | 771 | WP_000190226.1 | conserved phage C-terminal domain-containing protein | - |
| JMUB1273_RS10255 (JMUB1273_1913) | - | 1998460..1999119 (+) | 660 | WP_119267462.1 | hypothetical protein | - |
| JMUB1273_RS10260 (JMUB1273_1915) | - | 1999229..1999903 (-) | 675 | WP_063456299.1 | putative HNHc nuclease | - |
| JMUB1273_RS10265 (JMUB1273_1916) | ssbA | 1999915..2000358 (-) | 444 | WP_001099009.1 | single-stranded DNA-binding protein | Machinery gene |
| JMUB1273_RS10270 (JMUB1273_1917) | - | 2000355..2001005 (-) | 651 | WP_000840496.1 | ERF family protein | - |
| JMUB1273_RS10275 (JMUB1273_1918) | - | 2001006..2001542 (-) | 537 | WP_001004336.1 | host-nuclease inhibitor Gam family protein | - |
| JMUB1273_RS10280 (JMUB1273_1919) | - | 2001555..2001815 (-) | 261 | WP_031880059.1 | DUF1108 family protein | - |
| JMUB1273_RS10285 (JMUB1273_1920) | - | 2001796..2002125 (-) | 330 | WP_000138304.1 | hypothetical protein | - |
| JMUB1273_RS10290 (JMUB1273_1921) | - | 2002215..2002376 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| JMUB1273_RS10295 (JMUB1273_1922) | - | 2002373..2002693 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| JMUB1273_RS10300 (JMUB1273_1923) | - | 2002752..2003384 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| JMUB1273_RS10305 (JMUB1273_1924) | - | 2003399..2003539 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| JMUB1273_RS10310 (JMUB1273_1925) | - | 2003570..2003767 (-) | 198 | WP_001148861.1 | hypothetical protein | - |
| JMUB1273_RS10315 (JMUB1273_1926) | - | 2003783..2004532 (-) | 750 | WP_117207726.1 | phage antirepressor KilAC domain-containing protein | - |
| JMUB1273_RS10320 (JMUB1273_1927) | - | 2004589..2005128 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| JMUB1273_RS10325 (JMUB1273_1928) | - | 2005152..2005412 (-) | 261 | WP_000435341.1 | transcriptional regulator | - |
| JMUB1273_RS10330 (JMUB1273_1929) | - | 2005426..2006214 (-) | 789 | WP_070046044.1 | phage antirepressor | - |
| JMUB1273_RS10335 (JMUB1273_1930) | - | 2006230..2006472 (-) | 243 | WP_000639925.1 | DUF739 family protein | - |
| JMUB1273_RS10340 (JMUB1273_1931) | - | 2006636..2007352 (+) | 717 | WP_001083969.1 | LexA family transcriptional regulator | - |
| JMUB1273_RS10345 (JMUB1273_1932) | - | 2007552..2007719 (+) | 168 | WP_031808066.1 | hypothetical protein | - |
| JMUB1273_RS10350 (JMUB1273_1933) | - | 2007859..2008563 (+) | 705 | WP_017804779.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| JMUB1273_RS10355 (JMUB1273_1934) | - | 2008756..2009793 (+) | 1038 | WP_000857198.1 | tyrosine-type recombinase/integrase | - |
| JMUB1273_RS10360 (JMUB1273_1935) | sph | 2009850..2010674 (+) | 825 | Protein_1929 | sphingomyelin phosphodiesterase | - |
| JMUB1273_RS10365 (JMUB1273_1936) | lukG | 2010912..2011928 (-) | 1017 | WP_000595393.1 | bi-component leukocidin LukGH subunit G | - |
| JMUB1273_RS10370 (JMUB1273_1937) | lukH | 2011950..2013005 (-) | 1056 | WP_000791418.1 | bi-component leukocidin LukGH subunit H | - |
| JMUB1273_RS10375 (JMUB1273_1938) | - | 2013441..2014664 (+) | 1224 | WP_000206642.1 | ArgE/DapE family deacylase | - |
| JMUB1273_RS10380 (JMUB1273_1939) | - | 2015387..2015830 (-) | 444 | WP_000361985.1 | hypothetical protein | - |
| JMUB1273_RS10385 (JMUB1273_1940) | - | 2016718..2018025 (+) | 1308 | WP_119267463.1 | TrkH family potassium uptake protein | - |
| JMUB1273_RS10390 (JMUB1273_1941) | groL | 2018559..2020175 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| JMUB1273_RS10395 (JMUB1273_1942) | groES | 2020251..2020535 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16321.89 Da Isoelectric Point: 5.8347
>NTDB_id=71651 JMUB1273_RS10265 WP_001099009.1 1999915..2000358(-) (ssbA) [Staphylococcus aureus strain JMUB1273]
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF
Nucleotide
Download Length: 444 bp
>NTDB_id=71651 JMUB1273_RS10265 WP_001099009.1 1999915..2000358(-) (ssbA) [Staphylococcus aureus strain JMUB1273]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
41.279 |
100 |
0.483 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
38.235 |
100 |
0.442 |