Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   NRF13_RS12400 Genome accession   NZ_CP102350
Coordinates   2513961..2514275 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain PMC206     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2508961..2519275
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NRF13_RS12355 (NRF13_12355) sinI 2509644..2509817 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NRF13_RS12360 (NRF13_12360) sinR 2509851..2510186 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NRF13_RS12365 (NRF13_12365) tasA 2510234..2511019 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  NRF13_RS12370 (NRF13_12370) sipW 2511083..2511667 (-) 585 WP_012117977.1 signal peptidase I SipW -
  NRF13_RS12375 (NRF13_12375) tapA 2511639..2512310 (-) 672 WP_058906184.1 amyloid fiber anchoring/assembly protein TapA -
  NRF13_RS12380 (NRF13_12380) - 2512569..2512898 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  NRF13_RS12385 (NRF13_12385) - 2512938..2513117 (-) 180 WP_003153093.1 YqzE family protein -
  NRF13_RS12390 (NRF13_12390) comGG 2513174..2513551 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  NRF13_RS12395 (NRF13_12395) comGF 2513552..2513947 (-) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  NRF13_RS12400 (NRF13_12400) comGE 2513961..2514275 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  NRF13_RS12405 (NRF13_12405) comGD 2514259..2514696 (-) 438 WP_058906185.1 competence type IV pilus minor pilin ComGD Machinery gene
  NRF13_RS12410 (NRF13_12410) comGC 2514686..2514994 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  NRF13_RS12415 (NRF13_12415) comGB 2514999..2516036 (-) 1038 WP_058906186.1 competence type IV pilus assembly protein ComGB Machinery gene
  NRF13_RS12420 (NRF13_12420) comGA 2516023..2517093 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  NRF13_RS12425 (NRF13_12425) - 2517285..2518235 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=716345 NRF13_RS12400 WP_015388003.1 2513961..2514275(-) (comGE) [Bacillus velezensis strain PMC206]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=716345 NRF13_RS12400 WP_015388003.1 2513961..2514275(-) (comGE) [Bacillus velezensis strain PMC206]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481