Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NRF13_RS12355 Genome accession   NZ_CP102350
Coordinates   2509644..2509817 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain PMC206     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2504644..2514817
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NRF13_RS12340 (NRF13_12340) gcvT 2505462..2506562 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  NRF13_RS12345 (NRF13_12345) - 2506985..2508655 (+) 1671 WP_058906183.1 DEAD/DEAH box helicase -
  NRF13_RS12350 (NRF13_12350) - 2508673..2509467 (+) 795 WP_014305407.1 YqhG family protein -
  NRF13_RS12355 (NRF13_12355) sinI 2509644..2509817 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NRF13_RS12360 (NRF13_12360) sinR 2509851..2510186 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NRF13_RS12365 (NRF13_12365) tasA 2510234..2511019 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  NRF13_RS12370 (NRF13_12370) sipW 2511083..2511667 (-) 585 WP_012117977.1 signal peptidase I SipW -
  NRF13_RS12375 (NRF13_12375) tapA 2511639..2512310 (-) 672 WP_058906184.1 amyloid fiber anchoring/assembly protein TapA -
  NRF13_RS12380 (NRF13_12380) - 2512569..2512898 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  NRF13_RS12385 (NRF13_12385) - 2512938..2513117 (-) 180 WP_003153093.1 YqzE family protein -
  NRF13_RS12390 (NRF13_12390) comGG 2513174..2513551 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  NRF13_RS12395 (NRF13_12395) comGF 2513552..2513947 (-) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  NRF13_RS12400 (NRF13_12400) comGE 2513961..2514275 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  NRF13_RS12405 (NRF13_12405) comGD 2514259..2514696 (-) 438 WP_058906185.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=716342 NRF13_RS12355 WP_003153105.1 2509644..2509817(+) (sinI) [Bacillus velezensis strain PMC206]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=716342 NRF13_RS12355 WP_003153105.1 2509644..2509817(+) (sinI) [Bacillus velezensis strain PMC206]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702