Detailed information NTG0714967

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: OSR41_RS13275
• Genome accession: NZ_CP116941
• Coordinates: 2562349..2562786 (-)
• Length: 145 a.a.
• NCBI ID: WP_009327905.1
• Uniprot ID: Q8VQ70
• Organism: Bacillus licheniformis strain GN02
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2557349..2567786

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OSR41_RS13225 (OSR41_13225)	sinI	2557524..2557700 (+)	177	WP_003183444.1	anti-repressor SinI	Regulator
OSR41_RS13230 (OSR41_13230)	sinR	2557734..2558069 (+)	336	WP_025804940.1	transcriptional regulator SinR	Regulator
OSR41_RS13235 (OSR41_13235)	tasA	2558174..2558968 (-)	795	WP_003183447.1	biofilm matrix protein TasA	-
OSR41_RS13240 (OSR41_13240)	sipW	2559042..2559626 (-)	585	WP_003183449.1	signal peptidase I SipW	-
OSR41_RS13245 (OSR41_13245)	tapA	2559623..2560351 (-)	729	WP_003183451.1	amyloid fiber anchoring/assembly protein TapA	-
OSR41_RS13250 (OSR41_13250)	-	2560628..2560948 (+)	321	WP_003183454.1	YqzG/YhdC family protein	-
OSR41_RS13255 (OSR41_13255)	-	2560972..2561154 (-)	183	WP_003183456.1	YqzE family protein	-
OSR41_RS13260 (OSR41_13260)	comGG	2561243..2561608 (-)	366	WP_003183459.1	competence type IV pilus minor pilin ComGG	-
OSR41_RS13265 (OSR41_13265)	comGF	2561621..2562109 (-)	489	WP_011201694.1	competence type IV pilus minor pilin ComGF	-
OSR41_RS13270 (OSR41_13270)	comGE	2562018..2562365 (-)	348	WP_009327907.1	competence type IV pilus minor pilin ComGE	-
OSR41_RS13275 (OSR41_13275)	comGD	2562349..2562786 (-)	438	WP_009327905.1	competence type IV pilus minor pilin ComGD	Machinery gene
OSR41_RS13280 (OSR41_13280)	comGC	2562792..2563085 (-)	294	WP_003183466.1	competence type IV pilus major pilin ComGC	Machinery gene
OSR41_RS13285 (OSR41_13285)	comGB	2563099..2564133 (-)	1035	WP_011198115.1	competence type IV pilus assembly protein ComGB	Machinery gene
OSR41_RS13290 (OSR41_13290)	comGA	2564123..2565187 (-)	1065	WP_003183477.1	competence type IV pilus ATPase ComGA	Machinery gene
OSR41_RS13295 (OSR41_13295)	-	2565344..2566183 (-)	840	WP_003183480.1	STAS domain-containing protein	-
OSR41_RS13305 (OSR41_13305)	-	2566425..2566802 (-)	378	WP_003183482.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
OSR41_RS13310 (OSR41_13310)	-	2567011..2567256 (+)	246	WP_003183483.1	DUF2626 domain-containing protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16249.07 Da
• Isoelectric Point: 9.6739

>NTDB_id=714967 OSR41_RS13275 WP_009327905.1 2562349..2562786(-) (comGD) [Bacillus licheniformis strain GN02]
MNQKGFTLLESLTVLMIGSIMFSLLFALLPPIYEKRIVQHFVSQLEEDLLYAQQTALVRHTTVKVQFDFAGCRYIMKHSD
EGSSPELVRTYSCNIAIKKSTLKPILTFNPSGVPNQGGKIVIDTQHASFILTIYLGSGKINVQKK

Nucleotide

• Length: 438 bp

>NTDB_id=714967 OSR41_RS13275 WP_009327905.1 2562349..2562786(-) (comGD) [Bacillus licheniformis strain GN02]
ATGAATCAAAAAGGATTTACGCTTTTGGAAAGTTTAACTGTATTGATGATCGGTTCTATTATGTTCTCTCTTCTCTTTGC
TCTACTGCCTCCCATTTATGAAAAAAGAATCGTTCAGCACTTTGTCTCACAGCTTGAAGAGGATTTGCTTTACGCTCAGC
AGACGGCTCTCGTCCGCCATACGACGGTTAAGGTGCAGTTTGACTTTGCCGGCTGCCGCTATATCATGAAGCATTCGGAC
GAAGGCTCATCGCCTGAACTGGTCAGGACATACAGCTGCAATATCGCAATCAAAAAGTCGACGCTCAAACCAATTCTTAC
TTTTAATCCAAGCGGTGTTCCGAATCAAGGGGGAAAGATCGTGATCGATACACAGCATGCTTCTTTTATACTGACGATCT
ATTTAGGAAGCGGAAAGATTAATGTTCAAAAAAAATAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: Q8VQ70

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	39.86	98.621	0.393