Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   PPM45_RS12015 Genome accession   NZ_CP116870
Coordinates   2363324..2363497 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis subsp. subtilis strain Master_strain     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2358324..2368497
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PPM45_RS12000 gcvT 2359123..2360211 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  PPM45_RS12005 hepAA 2360653..2362326 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  PPM45_RS12010 yqhG 2362347..2363141 (+) 795 WP_003230200.1 YqhG family protein -
  PPM45_RS12015 sinI 2363324..2363497 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  PPM45_RS12020 sinR 2363531..2363866 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PPM45_RS12025 tasA 2363959..2364744 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  PPM45_RS12030 sipW 2364808..2365380 (-) 573 WP_003246088.1 signal peptidase I SipW -
  PPM45_RS12035 tapA 2365364..2366125 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  PPM45_RS12040 yqzG 2366397..2366723 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  PPM45_RS12045 spoIITA 2366765..2366944 (-) 180 WP_003230176.1 YqzE family protein -
  PPM45_RS12050 comGG 2367015..2367389 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  PPM45_RS12055 comGF 2367390..2367773 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  PPM45_RS12060 comGE 2367799..2368146 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=713856 PPM45_RS12015 WP_003230187.1 2363324..2363497(+) (sinI) [Bacillus subtilis subsp. subtilis strain Master_strain]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=713856 PPM45_RS12015 WP_003230187.1 2363324..2363497(+) (sinI) [Bacillus subtilis subsp. subtilis strain Master_strain]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1