Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   PPM45_RS12055 Genome accession   NZ_CP116870
Coordinates   2367390..2367773 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis subsp. subtilis strain Master_strain     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2362390..2372773
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PPM45_RS12015 sinI 2363324..2363497 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  PPM45_RS12020 sinR 2363531..2363866 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PPM45_RS12025 tasA 2363959..2364744 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  PPM45_RS12030 sipW 2364808..2365380 (-) 573 WP_003246088.1 signal peptidase I SipW -
  PPM45_RS12035 tapA 2365364..2366125 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  PPM45_RS12040 yqzG 2366397..2366723 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  PPM45_RS12045 spoIITA 2366765..2366944 (-) 180 WP_003230176.1 YqzE family protein -
  PPM45_RS12050 comGG 2367015..2367389 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  PPM45_RS12055 comGF 2367390..2367773 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  PPM45_RS12060 comGE 2367799..2368146 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  PPM45_RS12065 comGD 2368130..2368561 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  PPM45_RS12070 comGC 2368551..2368847 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  PPM45_RS12075 comGB 2368861..2369898 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  PPM45_RS12080 comGA 2369885..2370955 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  PPM45_RS12085 corA 2371367..2372320 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=713859 PPM45_RS12055 WP_003230168.1 2367390..2367773(-) (comGF) [Bacillus subtilis subsp. subtilis strain Master_strain]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=713859 PPM45_RS12055 WP_003230168.1 2367390..2367773(-) (comGF) [Bacillus subtilis subsp. subtilis strain Master_strain]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1