Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NP445_RS15100 Genome accession   NZ_CP101938
Coordinates   2881394..2881534 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain BDGP7     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2876394..2886534
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP445_RS15075 (NP445_15075) - 2876729..2877118 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  NP445_RS15080 (NP445_15080) comA 2877142..2877783 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  NP445_RS15085 (NP445_15085) comP 2877864..2880155 (-) 2292 WP_144665880.1 ATP-binding protein Regulator
  NP445_RS15090 (NP445_15090) comX 2880162..2880350 (-) 189 WP_306160900.1 competence pheromone ComX -
  NP445_RS15095 (NP445_15095) - 2880319..2881242 (-) 924 WP_047945349.1 polyprenyl synthetase family protein -
  NP445_RS15100 (NP445_15100) degQ 2881394..2881534 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NP445_RS15105 (NP445_15105) - 2882040..2882393 (+) 354 WP_017367963.1 hypothetical protein -
  NP445_RS15110 (NP445_15110) - 2882430..2883656 (-) 1227 WP_035701209.1 EAL and HDOD domain-containing protein -
  NP445_RS15115 (NP445_15115) - 2883797..2885206 (-) 1410 WP_230677047.1 nicotinate phosphoribosyltransferase -
  NP445_RS15120 (NP445_15120) - 2885284..2885835 (-) 552 WP_046526549.1 cysteine hydrolase family protein -
  NP445_RS15125 (NP445_15125) - 2885896..2886303 (-) 408 WP_173408242.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=713411 NP445_RS15100 WP_003213123.1 2881394..2881534(-) (degQ) [Bacillus altitudinis strain BDGP7]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=713411 NP445_RS15100 WP_003213123.1 2881394..2881534(-) (degQ) [Bacillus altitudinis strain BDGP7]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696