Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NP435_RS13225 Genome accession   NZ_CP101937
Coordinates   2531638..2531811 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain RUB331     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2526638..2536811
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP435_RS13210 (NP435_13210) gcvT 2527437..2528525 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  NP435_RS13215 (NP435_13215) hepAA 2528967..2530640 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  NP435_RS13220 (NP435_13220) yqhG 2530661..2531455 (+) 795 WP_003230200.1 YqhG family protein -
  NP435_RS13225 (NP435_13225) sinI 2531638..2531811 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NP435_RS13230 (NP435_13230) sinR 2531845..2532180 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NP435_RS13235 (NP435_13235) tasA 2532273..2533058 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  NP435_RS13240 (NP435_13240) sipW 2533122..2533694 (-) 573 WP_003246088.1 signal peptidase I SipW -
  NP435_RS13245 (NP435_13245) tapA 2533678..2534439 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  NP435_RS13250 (NP435_13250) yqzG 2534711..2535037 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NP435_RS13255 (NP435_13255) spoIITA 2535079..2535258 (-) 180 WP_003230176.1 YqzE family protein -
  NP435_RS13260 (NP435_13260) comGG 2535329..2535703 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  NP435_RS13265 (NP435_13265) comGF 2535704..2536087 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  NP435_RS13270 (NP435_13270) comGE 2536113..2536460 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=713322 NP435_RS13225 WP_003230187.1 2531638..2531811(+) (sinI) [Bacillus subtilis strain RUB331]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=713322 NP435_RS13225 WP_003230187.1 2531638..2531811(+) (sinI) [Bacillus subtilis strain RUB331]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1