Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NP435_RS13265 Genome accession   NZ_CP101937
Coordinates   2535704..2536087 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain RUB331     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2530704..2541087
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP435_RS13225 (NP435_13225) sinI 2531638..2531811 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NP435_RS13230 (NP435_13230) sinR 2531845..2532180 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NP435_RS13235 (NP435_13235) tasA 2532273..2533058 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  NP435_RS13240 (NP435_13240) sipW 2533122..2533694 (-) 573 WP_003246088.1 signal peptidase I SipW -
  NP435_RS13245 (NP435_13245) tapA 2533678..2534439 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  NP435_RS13250 (NP435_13250) yqzG 2534711..2535037 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NP435_RS13255 (NP435_13255) spoIITA 2535079..2535258 (-) 180 WP_003230176.1 YqzE family protein -
  NP435_RS13260 (NP435_13260) comGG 2535329..2535703 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  NP435_RS13265 (NP435_13265) comGF 2535704..2536087 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  NP435_RS13270 (NP435_13270) comGE 2536113..2536460 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  NP435_RS13275 (NP435_13275) comGD 2536444..2536875 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  NP435_RS13280 (NP435_13280) comGC 2536865..2537161 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NP435_RS13285 (NP435_13285) comGB 2537175..2538212 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  NP435_RS13290 (NP435_13290) comGA 2538199..2539269 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NP435_RS13295 (NP435_13295) corA 2539681..2540634 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=713325 NP435_RS13265 WP_003230168.1 2535704..2536087(-) (comGF) [Bacillus subtilis strain RUB331]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=713325 NP435_RS13265 WP_003230168.1 2535704..2536087(-) (comGF) [Bacillus subtilis strain RUB331]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1