Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NP433_RS12305 Genome accession   NZ_CP101930
Coordinates   2424382..2424765 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus subtilis strain BGSC 10A5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2419382..2429765
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP433_RS12265 (NP433_12265) sinI 2420315..2420488 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NP433_RS12270 (NP433_12270) sinR 2420522..2420857 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NP433_RS12275 (NP433_12275) tasA 2420950..2421735 (-) 786 WP_212130175.1 biofilm matrix protein TasA -
  NP433_RS12280 (NP433_12280) sipW 2421799..2422371 (-) 573 WP_003246088.1 signal peptidase I SipW -
  NP433_RS12285 (NP433_12285) tapA 2422355..2423116 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  NP433_RS12290 (NP433_12290) yqzG 2423388..2423714 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NP433_RS12295 (NP433_12295) spoIITA 2423756..2423935 (-) 180 WP_029726723.1 YqzE family protein -
  NP433_RS12300 (NP433_12300) comGG 2424007..2424381 (-) 375 WP_167408283.1 ComG operon protein ComGG Machinery gene
  NP433_RS12305 (NP433_12305) comGF 2424382..2424765 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  NP433_RS12310 (NP433_12310) comGE 2424791..2425138 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  NP433_RS12315 (NP433_12315) comGD 2425122..2425553 (-) 432 WP_256682874.1 comG operon protein ComGD Machinery gene
  NP433_RS12320 (NP433_12320) comGC 2425543..2425839 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NP433_RS12325 (NP433_12325) comGB 2425853..2426890 (-) 1038 WP_116316545.1 comG operon protein ComGB Machinery gene
  NP433_RS12330 (NP433_12330) comGA 2426877..2427947 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  NP433_RS12335 (NP433_12335) corA 2428359..2429312 (-) 954 WP_256682875.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=713007 NP433_RS12305 WP_032726158.1 2424382..2424765(-) (comGF) [Bacillus subtilis strain BGSC 10A5]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=713007 NP433_RS12305 WP_032726158.1 2424382..2424765(-) (comGF) [Bacillus subtilis strain BGSC 10A5]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGTG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992