Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NPS25_RS15480 Genome accession   NZ_CP101904
Coordinates   3146371..3146511 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain Ba-0321     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3141371..3151511
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NPS25_RS15455 (NPS25_15455) - 3141667..3142050 (-) 384 WP_095352718.1 hotdog fold thioesterase -
  NPS25_RS15460 (NPS25_15460) comA 3142072..3142716 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  NPS25_RS15465 (NPS25_15465) comP 3142797..3145106 (-) 2310 WP_033574914.1 histidine kinase Regulator
  NPS25_RS15470 (NPS25_15470) comX 3145126..3145302 (-) 177 WP_007408675.1 competence pheromone ComX -
  NPS25_RS15475 (NPS25_15475) comQ 3145302..3146240 (-) 939 WP_269465507.1 class 1 isoprenoid biosynthesis enzyme Regulator
  NPS25_RS15480 (NPS25_15480) degQ 3146371..3146511 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  NPS25_RS15485 (NPS25_15485) - 3146977..3147318 (+) 342 WP_015418107.1 hypothetical protein -
  NPS25_RS15490 (NPS25_15490) - 3147325..3148548 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  NPS25_RS15495 (NPS25_15495) - 3148678..3150144 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  NPS25_RS15500 (NPS25_15500) - 3150162..3150713 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  NPS25_RS15505 (NPS25_15505) - 3150810..3151208 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=712604 NPS25_RS15480 WP_003152043.1 3146371..3146511(-) (degQ) [Bacillus velezensis strain Ba-0321]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=712604 NPS25_RS15480 WP_003152043.1 3146371..3146511(-) (degQ) [Bacillus velezensis strain Ba-0321]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891