Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   NPS25_RS12515 Genome accession   NZ_CP101904
Coordinates   2587331..2587708 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain Ba-0321     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2582331..2592708
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NPS25_RS12475 (NPS25_12475) - 2582828..2583622 (+) 795 WP_156240427.1 YqhG family protein -
  NPS25_RS12480 (NPS25_12480) sinI 2583799..2583972 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NPS25_RS12485 (NPS25_12485) sinR 2584006..2584341 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NPS25_RS12490 (NPS25_12490) tasA 2584389..2585174 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  NPS25_RS12495 (NPS25_12495) sipW 2585239..2585823 (-) 585 WP_015240205.1 signal peptidase I SipW -
  NPS25_RS12500 (NPS25_12500) tapA 2585795..2586466 (-) 672 WP_113766732.1 amyloid fiber anchoring/assembly protein TapA -
  NPS25_RS12505 (NPS25_12505) - 2586725..2587054 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  NPS25_RS12510 (NPS25_12510) - 2587095..2587274 (-) 180 WP_003153093.1 YqzE family protein -
  NPS25_RS12515 (NPS25_12515) comGG 2587331..2587708 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  NPS25_RS12520 (NPS25_12520) comGF 2587709..2588209 (-) 501 WP_256683588.1 competence type IV pilus minor pilin ComGF -
  NPS25_RS12525 (NPS25_12525) comGE 2588118..2588432 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  NPS25_RS12530 (NPS25_12530) comGD 2588416..2588853 (-) 438 WP_256683589.1 competence type IV pilus minor pilin ComGD Machinery gene
  NPS25_RS12535 (NPS25_12535) comGC 2588843..2589151 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  NPS25_RS12540 (NPS25_12540) comGB 2589156..2590193 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  NPS25_RS12545 (NPS25_12545) comGA 2590180..2591250 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  NPS25_RS12550 (NPS25_12550) - 2591443..2592393 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=712584 NPS25_RS12515 WP_015417814.1 2587331..2587708(-) (comGG) [Bacillus velezensis strain Ba-0321]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=712584 NPS25_RS12515 WP_015417814.1 2587331..2587708(-) (comGG) [Bacillus velezensis strain Ba-0321]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504