Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NPS25_RS12480 Genome accession   NZ_CP101904
Coordinates   2583799..2583972 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Ba-0321     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2578799..2588972
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NPS25_RS12465 (NPS25_12465) gcvT 2579612..2580712 (-) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -
  NPS25_RS12470 (NPS25_12470) - 2581136..2582806 (+) 1671 WP_015417810.1 DEAD/DEAH box helicase -
  NPS25_RS12475 (NPS25_12475) - 2582828..2583622 (+) 795 WP_156240427.1 YqhG family protein -
  NPS25_RS12480 (NPS25_12480) sinI 2583799..2583972 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NPS25_RS12485 (NPS25_12485) sinR 2584006..2584341 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NPS25_RS12490 (NPS25_12490) tasA 2584389..2585174 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  NPS25_RS12495 (NPS25_12495) sipW 2585239..2585823 (-) 585 WP_015240205.1 signal peptidase I SipW -
  NPS25_RS12500 (NPS25_12500) tapA 2585795..2586466 (-) 672 WP_113766732.1 amyloid fiber anchoring/assembly protein TapA -
  NPS25_RS12505 (NPS25_12505) - 2586725..2587054 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  NPS25_RS12510 (NPS25_12510) - 2587095..2587274 (-) 180 WP_003153093.1 YqzE family protein -
  NPS25_RS12515 (NPS25_12515) comGG 2587331..2587708 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  NPS25_RS12520 (NPS25_12520) comGF 2587709..2588209 (-) 501 WP_256683588.1 competence type IV pilus minor pilin ComGF -
  NPS25_RS12525 (NPS25_12525) comGE 2588118..2588432 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  NPS25_RS12530 (NPS25_12530) comGD 2588416..2588853 (-) 438 WP_256683589.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=712582 NPS25_RS12480 WP_003153105.1 2583799..2583972(+) (sinI) [Bacillus velezensis strain Ba-0321]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=712582 NPS25_RS12480 WP_003153105.1 2583799..2583972(+) (sinI) [Bacillus velezensis strain Ba-0321]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702