Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NPA28_RS12725 Genome accession   NZ_CP101718
Coordinates   2522145..2522528 (-) Length   127 a.a.
NCBI ID   WP_217827778.1    Uniprot ID   -
Organism   Bacillus halotolerans strain S-5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2517145..2527528
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NPA28_RS12685 (NPA28_12685) sinI 2518081..2518254 (+) 174 WP_024122036.1 anti-repressor SinI Regulator
  NPA28_RS12690 (NPA28_12690) sinR 2518288..2518623 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NPA28_RS12695 (NPA28_12695) tasA 2518709..2519494 (-) 786 WP_059293609.1 biofilm matrix protein TasA -
  NPA28_RS12700 (NPA28_12700) sipW 2519559..2520143 (-) 585 WP_059293608.1 signal peptidase I SipW -
  NPA28_RS12705 (NPA28_12705) tapA 2520115..2520876 (-) 762 WP_217827776.1 amyloid fiber anchoring/assembly protein TapA -
  NPA28_RS12710 (NPA28_12710) - 2521153..2521476 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  NPA28_RS12715 (NPA28_12715) - 2521519..2521698 (-) 180 WP_003236949.1 YqzE family protein -
  NPA28_RS12720 (NPA28_12720) comGG 2521770..2522144 (-) 375 WP_217827777.1 competence type IV pilus minor pilin ComGG Machinery gene
  NPA28_RS12725 (NPA28_12725) comGF 2522145..2522528 (-) 384 WP_217827778.1 competence type IV pilus minor pilin ComGF Machinery gene
  NPA28_RS12730 (NPA28_12730) comGE 2522554..2522901 (-) 348 WP_217827779.1 competence type IV pilus minor pilin ComGE Machinery gene
  NPA28_RS12735 (NPA28_12735) comGD 2522885..2523316 (-) 432 WP_217827780.1 competence type IV pilus minor pilin ComGD Machinery gene
  NPA28_RS12740 (NPA28_12740) comGC 2523306..2523602 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  NPA28_RS12745 (NPA28_12745) comGB 2523616..2524653 (-) 1038 WP_217827781.1 competence type IV pilus assembly protein ComGB Machinery gene
  NPA28_RS12750 (NPA28_12750) comGA 2524640..2525710 (-) 1071 WP_217827782.1 competence protein ComGA Machinery gene
  NPA28_RS12755 (NPA28_12755) - 2526032..2526442 (-) 411 WP_217827783.1 CBS domain-containing protein -
  NPA28_RS12760 (NPA28_12760) corA 2526505..2527458 (-) 954 WP_217827784.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14683.85 Da        Isoelectric Point: 7.3829

>NTDB_id=711763 NPA28_RS12725 WP_217827778.1 2522145..2522528(-) (comGF) [Bacillus halotolerans strain S-5]
MLISGSLAMYFHLFLSRQQENEGFMQREWVISVEQIMNECKQSQTVQTDEHGSVLICRNLSGQEVRFEIYHSMIRKRVDG
KGHVPILDHIKTMKAEVKNGMLWLKVKNENDKEYQTAFSVYTSLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=711763 NPA28_RS12725 WP_217827778.1 2522145..2522528(-) (comGF) [Bacillus halotolerans strain S-5]
TTGCTCATATCAGGATCGTTAGCGATGTACTTTCATCTATTTTTGTCACGTCAACAGGAGAATGAGGGCTTCATGCAGCG
GGAATGGGTCATTTCGGTAGAGCAGATCATGAATGAGTGCAAGCAATCGCAGACAGTGCAGACAGATGAGCATGGGAGCG
TCTTAATCTGCAGAAATCTGTCAGGGCAAGAGGTCCGTTTTGAAATCTACCATTCAATGATCAGGAAAAGAGTAGACGGA
AAAGGGCATGTTCCGATTCTTGACCATATTAAAACAATGAAAGCCGAGGTTAAAAACGGGATGCTTTGGCTGAAAGTCAA
GAATGAGAATGATAAAGAGTATCAAACAGCTTTTTCGGTATATACGTCGTTAGGAGGTGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

72.441

100

0.724