Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NO220_RS14790 Genome accession   NZ_CP101661
Coordinates   3009667..3009807 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain B408     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3004667..3014807
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NO220_RS14765 (NO220_14765) - 3004964..3005347 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  NO220_RS14770 (NO220_14770) comA 3005369..3006013 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  NO220_RS14775 (NO220_14775) comP 3006094..3008397 (-) 2304 WP_003152050.1 histidine kinase Regulator
  NO220_RS14780 (NO220_14780) comX 3008417..3008596 (-) 180 WP_306383677.1 competence pheromone ComX -
  NO220_RS14785 (NO220_14785) comQ 3008550..3009536 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  NO220_RS14790 (NO220_14790) degQ 3009667..3009807 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  NO220_RS14795 (NO220_14795) - 3010273..3010614 (+) 342 WP_014305721.1 hypothetical protein -
  NO220_RS14800 (NO220_14800) - 3010621..3011841 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  NO220_RS14805 (NO220_14805) - 3011971..3013437 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  NO220_RS14810 (NO220_14810) - 3013455..3014006 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  NO220_RS14815 (NO220_14815) - 3014103..3014501 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=711458 NO220_RS14790 WP_003152043.1 3009667..3009807(-) (degQ) [Bacillus amyloliquefaciens strain B408]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=711458 NO220_RS14790 WP_003152043.1 3009667..3009807(-) (degQ) [Bacillus amyloliquefaciens strain B408]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891