Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   NO220_RS11900 Genome accession   NZ_CP101661
Coordinates   2460783..2461097 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain B408     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2455783..2466097
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NO220_RS11855 (NO220_11855) sinI 2456466..2456639 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NO220_RS11860 (NO220_11860) sinR 2456673..2457008 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NO220_RS11865 (NO220_11865) tasA 2457056..2457841 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  NO220_RS11870 (NO220_11870) sipW 2457905..2458489 (-) 585 WP_012117977.1 signal peptidase I SipW -
  NO220_RS11875 (NO220_11875) tapA 2458461..2459132 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  NO220_RS11880 (NO220_11880) - 2459391..2459720 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  NO220_RS11885 (NO220_11885) - 2459760..2459939 (-) 180 WP_003153093.1 YqzE family protein -
  NO220_RS11890 (NO220_11890) comGG 2459996..2460373 (-) 378 WP_043867284.1 competence type IV pilus minor pilin ComGG Machinery gene
  NO220_RS11895 (NO220_11895) comGF 2460374..2460769 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  NO220_RS11900 (NO220_11900) comGE 2460783..2461097 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  NO220_RS11905 (NO220_11905) comGD 2461081..2461518 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  NO220_RS11910 (NO220_11910) comGC 2461508..2461816 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  NO220_RS11915 (NO220_11915) comGB 2461821..2462858 (-) 1038 WP_043867286.1 competence type IV pilus assembly protein ComGB Machinery gene
  NO220_RS11920 (NO220_11920) comGA 2462845..2463915 (-) 1071 WP_043867287.1 competence type IV pilus ATPase ComGA Machinery gene
  NO220_RS11925 (NO220_11925) - 2464113..2465063 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=711438 NO220_RS11900 WP_015388003.1 2460783..2461097(-) (comGE) [Bacillus amyloliquefaciens strain B408]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=711438 NO220_RS11900 WP_015388003.1 2460783..2461097(-) (comGE) [Bacillus amyloliquefaciens strain B408]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481