Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NO220_RS11855 Genome accession   NZ_CP101661
Coordinates   2456466..2456639 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain B408     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2451466..2461639
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NO220_RS11840 (NO220_11840) gcvT 2452284..2453384 (-) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -
  NO220_RS11845 (NO220_11845) - 2453807..2455477 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  NO220_RS11850 (NO220_11850) - 2455495..2456289 (+) 795 WP_014305407.1 YqhG family protein -
  NO220_RS11855 (NO220_11855) sinI 2456466..2456639 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NO220_RS11860 (NO220_11860) sinR 2456673..2457008 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NO220_RS11865 (NO220_11865) tasA 2457056..2457841 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  NO220_RS11870 (NO220_11870) sipW 2457905..2458489 (-) 585 WP_012117977.1 signal peptidase I SipW -
  NO220_RS11875 (NO220_11875) tapA 2458461..2459132 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  NO220_RS11880 (NO220_11880) - 2459391..2459720 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  NO220_RS11885 (NO220_11885) - 2459760..2459939 (-) 180 WP_003153093.1 YqzE family protein -
  NO220_RS11890 (NO220_11890) comGG 2459996..2460373 (-) 378 WP_043867284.1 competence type IV pilus minor pilin ComGG Machinery gene
  NO220_RS11895 (NO220_11895) comGF 2460374..2460769 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  NO220_RS11900 (NO220_11900) comGE 2460783..2461097 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  NO220_RS11905 (NO220_11905) comGD 2461081..2461518 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=711435 NO220_RS11855 WP_003153105.1 2456466..2456639(+) (sinI) [Bacillus amyloliquefaciens strain B408]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=711435 NO220_RS11855 WP_003153105.1 2456466..2456639(+) (sinI) [Bacillus amyloliquefaciens strain B408]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702