Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NN913_RS14995 Genome accession   NZ_CP101621
Coordinates   3031443..3031583 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain 906     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3026443..3036583
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NN913_RS14970 (NN913_14930) - 3026789..3027172 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  NN913_RS14975 (NN913_14935) comA 3027194..3027838 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  NN913_RS14980 (NN913_14940) comP 3027919..3030219 (-) 2301 WP_236837055.1 histidine kinase Regulator
  NN913_RS14985 (NN913_14945) comX 3030233..3030406 (-) 174 WP_012118314.1 competence pheromone ComX -
  NN913_RS14990 (NN913_14950) - 3030375..3031235 (-) 861 WP_159073777.1 polyprenyl synthetase family protein -
  NN913_RS14995 (NN913_14955) degQ 3031443..3031583 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  NN913_RS15000 (NN913_14960) - 3032049..3032390 (+) 342 WP_014305721.1 hypothetical protein -
  NN913_RS15005 (NN913_14965) - 3032397..3033617 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  NN913_RS15010 (NN913_14970) - 3033747..3035213 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  NN913_RS15015 (NN913_14975) - 3035231..3035782 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  NN913_RS15020 (NN913_14980) - 3035879..3036277 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=711040 NN913_RS14995 WP_003152043.1 3031443..3031583(-) (degQ) [Bacillus velezensis strain 906]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=711040 NN913_RS14995 WP_003152043.1 3031443..3031583(-) (degQ) [Bacillus velezensis strain 906]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891