Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NN913_RS12030 Genome accession   NZ_CP101621
Coordinates   2477811..2477984 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain 906     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2472811..2482984
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NN913_RS12015 (NN913_11995) gcvT 2473628..2474728 (-) 1101 WP_024085597.1 glycine cleavage system aminomethyltransferase GcvT -
  NN913_RS12020 (NN913_12000) - 2475152..2476822 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  NN913_RS12025 (NN913_12005) - 2476840..2477634 (+) 795 WP_014305407.1 YqhG family protein -
  NN913_RS12030 (NN913_12010) sinI 2477811..2477984 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NN913_RS12035 (NN913_12015) sinR 2478018..2478353 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NN913_RS12040 (NN913_12020) tasA 2478401..2479186 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  NN913_RS12045 (NN913_12025) sipW 2479250..2479834 (-) 585 WP_012117977.1 signal peptidase I SipW -
  NN913_RS12050 (NN913_12030) tapA 2479806..2480477 (-) 672 WP_234949395.1 amyloid fiber anchoring/assembly protein TapA -
  NN913_RS12055 (NN913_12035) - 2480736..2481065 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  NN913_RS12060 (NN913_12040) - 2481105..2481284 (-) 180 WP_003153093.1 YqzE family protein -
  NN913_RS12065 (NN913_12045) comGG 2481341..2481718 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  NN913_RS12070 (NN913_12050) comGF 2481719..2482114 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  NN913_RS12075 (NN913_12055) comGE 2482128..2482442 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  NN913_RS12080 (NN913_12060) comGD 2482426..2482863 (-) 438 WP_003153088.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=711019 NN913_RS12030 WP_003153105.1 2477811..2477984(+) (sinI) [Bacillus velezensis strain 906]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=711019 NN913_RS12030 WP_003153105.1 2477811..2477984(+) (sinI) [Bacillus velezensis strain 906]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702