Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | NN913_RS12030 | Genome accession | NZ_CP101621 |
| Coordinates | 2477811..2477984 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain 906 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2472811..2482984
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NN913_RS12015 (NN913_11995) | gcvT | 2473628..2474728 (-) | 1101 | WP_024085597.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NN913_RS12020 (NN913_12000) | - | 2475152..2476822 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| NN913_RS12025 (NN913_12005) | - | 2476840..2477634 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| NN913_RS12030 (NN913_12010) | sinI | 2477811..2477984 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| NN913_RS12035 (NN913_12015) | sinR | 2478018..2478353 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| NN913_RS12040 (NN913_12020) | tasA | 2478401..2479186 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| NN913_RS12045 (NN913_12025) | sipW | 2479250..2479834 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| NN913_RS12050 (NN913_12030) | tapA | 2479806..2480477 (-) | 672 | WP_234949395.1 | amyloid fiber anchoring/assembly protein TapA | - |
| NN913_RS12055 (NN913_12035) | - | 2480736..2481065 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| NN913_RS12060 (NN913_12040) | - | 2481105..2481284 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| NN913_RS12065 (NN913_12045) | comGG | 2481341..2481718 (-) | 378 | WP_003153092.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| NN913_RS12070 (NN913_12050) | comGF | 2481719..2482114 (-) | 396 | WP_003153090.1 | competence type IV pilus minor pilin ComGF | - |
| NN913_RS12075 (NN913_12055) | comGE | 2482128..2482442 (-) | 315 | WP_003153089.1 | competence type IV pilus minor pilin ComGE | - |
| NN913_RS12080 (NN913_12060) | comGD | 2482426..2482863 (-) | 438 | WP_003153088.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=711019 NN913_RS12030 WP_003153105.1 2477811..2477984(+) (sinI) [Bacillus velezensis strain 906]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=711019 NN913_RS12030 WP_003153105.1 2477811..2477984(+) (sinI) [Bacillus velezensis strain 906]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGTCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |