Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NMH04_RS15375 Genome accession   NZ_CP101609
Coordinates   2948866..2949006 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain 47     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2943866..2954006
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NMH04_RS15350 (NMH04_15290) - 2944132..2944521 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  NMH04_RS15355 (NMH04_15295) comA 2944545..2945186 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  NMH04_RS15360 (NMH04_15300) comP 2945267..2947579 (-) 2313 WP_041507704.1 ATP-binding protein Regulator
  NMH04_RS15365 (NMH04_15305) comX 2947633..2947803 (-) 171 WP_074041927.1 competence pheromone ComX -
  NMH04_RS15370 (NMH04_15310) - 2947800..2948714 (-) 915 WP_168948551.1 polyprenyl synthetase family protein -
  NMH04_RS15375 (NMH04_15315) degQ 2948866..2949006 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NMH04_RS15380 (NMH04_15320) - 2949512..2949865 (+) 354 WP_017367963.1 hypothetical protein -
  NMH04_RS15385 (NMH04_15325) - 2949902..2951128 (-) 1227 WP_035701209.1 EAL and HDOD domain-containing protein -
  NMH04_RS15390 (NMH04_15330) - 2951269..2952738 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  NMH04_RS15395 (NMH04_15335) - 2952756..2953307 (-) 552 WP_019743368.1 cysteine hydrolase family protein -
  NMH04_RS15400 (NMH04_15340) - 2953368..2953775 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=710809 NMH04_RS15375 WP_003213123.1 2948866..2949006(-) (degQ) [Bacillus altitudinis strain 47]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=710809 NMH04_RS15375 WP_003213123.1 2948866..2949006(-) (degQ) [Bacillus altitudinis strain 47]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696