Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NM966_RS15330 Genome accession   NZ_CP101506
Coordinates   2913975..2914115 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain B12     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2908975..2919115
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NM966_RS15305 (NM966_15250) - 2909297..2909686 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  NM966_RS15310 (NM966_15255) comA 2909710..2910351 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  NM966_RS15315 (NM966_15260) comP 2910432..2912738 (-) 2307 WP_017358942.1 ATP-binding protein Regulator
  NM966_RS15320 (NM966_15265) comX 2912752..2912922 (-) 171 WP_017358941.1 competence pheromone ComX -
  NM966_RS15325 (NM966_15270) - 2912900..2913823 (-) 924 WP_017358940.1 polyprenyl synthetase family protein -
  NM966_RS15330 (NM966_15275) degQ 2913975..2914115 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NM966_RS15335 (NM966_15280) - 2914621..2914974 (+) 354 WP_017367963.1 hypothetical protein -
  NM966_RS15340 (NM966_15285) - 2915011..2916237 (-) 1227 WP_017367964.1 EAL and HDOD domain-containing protein -
  NM966_RS15345 (NM966_15290) - 2916378..2917787 (-) 1410 WP_230677047.1 nicotinate phosphoribosyltransferase -
  NM966_RS15350 (NM966_15295) - 2917865..2918416 (-) 552 WP_008345872.1 cysteine hydrolase family protein -
  NM966_RS15355 (NM966_15300) - 2918477..2918884 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=710312 NM966_RS15330 WP_003213123.1 2913975..2914115(-) (degQ) [Bacillus altitudinis strain B12]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=710312 NM966_RS15330 WP_003213123.1 2913975..2914115(-) (degQ) [Bacillus altitudinis strain B12]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696