Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NMT99_RS12380 Genome accession   NZ_CP101290
Coordinates   2413318..2413491 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain LjM2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2408318..2418491
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NMT99_RS12365 gcvT 2409118..2410206 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  NMT99_RS12370 hepAA 2410647..2412320 (+) 1674 WP_029726726.1 DEAD/DEAH box helicase -
  NMT99_RS12375 yqhG 2412341..2413135 (+) 795 WP_015714249.1 YqhG family protein -
  NMT99_RS12380 sinI 2413318..2413491 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NMT99_RS12385 sinR 2413525..2413860 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NMT99_RS12390 tasA 2413953..2414738 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  NMT99_RS12395 sipW 2414802..2415374 (-) 573 WP_072692741.1 signal peptidase I SipW -
  NMT99_RS12400 tapA 2415358..2416119 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  NMT99_RS12405 yqzG 2416390..2416716 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NMT99_RS12410 spoIITA 2416758..2416937 (-) 180 WP_029726723.1 YqzE family protein -
  NMT99_RS12415 comGG 2417009..2417383 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  NMT99_RS12420 comGF 2417384..2417767 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  NMT99_RS12425 comGE 2417793..2418140 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=709476 NMT99_RS12380 WP_003230187.1 2413318..2413491(+) (sinI) [Bacillus subtilis strain LjM2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=709476 NMT99_RS12380 WP_003230187.1 2413318..2413491(+) (sinI) [Bacillus subtilis strain LjM2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1