Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   PF977_RS04825 Genome accession   NZ_CP116012
Coordinates   952626..952766 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM124333     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 947626..957766
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF977_RS04795 (PF977_04795) yueI 947921..948319 (+) 399 WP_015714628.1 YueI family protein -
  PF977_RS04800 (PF977_04800) pncA 948416..948967 (+) 552 WP_015714627.1 cysteine hydrolase family protein -
  PF977_RS04805 (PF977_04805) pncB 948983..950455 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  PF977_RS04810 (PF977_04810) pdeH 950592..951821 (+) 1230 WP_003228790.1 cyclic di-GMP phosphodiesterase -
  PF977_RS04815 (PF977_04815) - 951797..952165 (-) 369 WP_014477834.1 hypothetical protein -
  PF977_RS04820 (PF977_04820) - 952279..952404 (-) 126 WP_003228793.1 hypothetical protein -
  PF977_RS04825 (PF977_04825) degQ 952626..952766 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  PF977_RS04830 (PF977_04830) comQ 952951..953820 (+) 870 WP_015714626.1 polyprenyl synthetase family protein Regulator
  PF977_RS04835 (PF977_04835) comX 953817..954038 (+) 222 WP_014114983.1 competence pheromone ComX -
  PF977_RS04840 (PF977_04840) comP 954054..956366 (+) 2313 WP_144460405.1 histidine kinase Regulator
  PF977_RS04845 (PF977_04845) comA 956447..957091 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  PF977_RS04850 (PF977_04850) yuxO 957110..957490 (+) 381 WP_015714624.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=706856 PF977_RS04825 WP_003220708.1 952626..952766(+) (degQ) [Bacillus subtilis strain SRCM124333]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=706856 PF977_RS04825 WP_003220708.1 952626..952766(+) (degQ) [Bacillus subtilis strain SRCM124333]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1