Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   NLV76_RS12750 Genome accession   NZ_CP100752
Coordinates   2485556..2485930 (-) Length   124 a.a.
NCBI ID   WP_059335411.1    Uniprot ID   -
Organism   Bacillus halotolerans strain MEC_B301     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2480556..2490930
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NLV76_RS12710 (NLV76_12710) - 2480888..2481682 (+) 795 WP_254500939.1 YqhG family protein -
  NLV76_RS12715 (NLV76_12715) sinI 2481866..2482039 (+) 174 WP_024122036.1 anti-repressor SinI Regulator
  NLV76_RS12720 (NLV76_12720) sinR 2482073..2482408 (+) 336 WP_254500940.1 transcriptional regulator SinR Regulator
  NLV76_RS12725 (NLV76_12725) tasA 2482495..2483280 (-) 786 WP_254500941.1 biofilm matrix protein TasA -
  NLV76_RS12730 (NLV76_12730) sipW 2483345..2483929 (-) 585 WP_059293608.1 signal peptidase I SipW -
  NLV76_RS12735 (NLV76_12735) tapA 2483901..2484662 (-) 762 WP_254500942.1 amyloid fiber anchoring/assembly protein TapA -
  NLV76_RS12740 (NLV76_12740) - 2484939..2485262 (+) 324 WP_254500943.1 YqzG/YhdC family protein -
  NLV76_RS12745 (NLV76_12745) - 2485305..2485484 (-) 180 WP_003236949.1 YqzE family protein -
  NLV76_RS12750 (NLV76_12750) comGG 2485556..2485930 (-) 375 WP_059335411.1 competence type IV pilus minor pilin ComGG Machinery gene
  NLV76_RS12755 (NLV76_12755) comGF 2485931..2486314 (-) 384 WP_227533974.1 competence type IV pilus minor pilin ComGF Machinery gene
  NLV76_RS12760 (NLV76_12760) comGE 2486340..2486687 (-) 348 WP_059352380.1 competence type IV pilus minor pilin ComGE Machinery gene
  NLV76_RS12765 (NLV76_12765) comGD 2486671..2487102 (-) 432 WP_044154579.1 competence type IV pilus minor pilin ComGD Machinery gene
  NLV76_RS12770 (NLV76_12770) comGC 2487092..2487388 (-) 297 WP_044154578.1 competence type IV pilus major pilin ComGC Machinery gene
  NLV76_RS12775 (NLV76_12775) comGB 2487402..2488439 (-) 1038 WP_302329767.1 competence type IV pilus assembly protein ComGB Machinery gene
  NLV76_RS12780 (NLV76_12780) comGA 2488426..2489496 (-) 1071 WP_254500944.1 competence protein ComGA Machinery gene
  NLV76_RS12785 (NLV76_12785) - 2489817..2490227 (-) 411 WP_193659474.1 CBS domain-containing protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14511.65 Da        Isoelectric Point: 9.5334

>NTDB_id=706686 NLV76_RS12750 WP_059335411.1 2485556..2485930(-) (comGG) [Bacillus halotolerans strain MEC_B301]
MYYSKGFIYPAVLFTFALVMLIVNFTAPQFVSRHMFEKETKEYYTGENLLQNGALLSIRHILEHRPGRKGSQQFQYGHVS
YDIRKTTIKEQQEITLKAITESGTEKNAQLLFDQNQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=706686 NLV76_RS12750 WP_059335411.1 2485556..2485930(-) (comGG) [Bacillus halotolerans strain MEC_B301]
ATGTACTACTCAAAAGGGTTTATCTATCCGGCCGTTCTTTTTACATTTGCCCTTGTGATGCTGATTGTGAATTTCACCGC
CCCTCAATTTGTTTCACGCCATATGTTTGAGAAGGAAACAAAAGAGTATTACACAGGAGAAAATCTGCTGCAAAATGGCG
CGCTTCTATCCATCAGGCATATACTTGAGCACAGACCAGGCCGAAAGGGTTCACAGCAGTTTCAATATGGACATGTATCT
TATGACATTCGCAAAACAACCATAAAAGAACAGCAAGAAATCACCCTTAAAGCCATCACAGAGTCGGGAACAGAAAAAAA
CGCTCAGCTGCTGTTCGATCAAAATCAGAAAAAACTGCTGAGCTGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(31-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

69.355

100

0.694