Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NLK52_RS15685 Genome accession   NZ_CP100436
Coordinates   3036773..3036913 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain MEC_B298     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3031773..3041913
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NLK52_RS15660 (NLK52_15660) yuxO 3032116..3032496 (-) 381 WP_015483631.1 hotdog fold thioesterase -
  NLK52_RS15665 (NLK52_15665) comA 3032514..3033158 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NLK52_RS15670 (NLK52_15670) comP 3033239..3035539 (-) 2301 WP_046340263.1 histidine kinase Regulator
  NLK52_RS15675 (NLK52_15675) comX 3035551..3035715 (-) 165 WP_015384519.1 competence pheromone ComX -
  NLK52_RS15680 (NLK52_15680) - 3035728..3036588 (-) 861 WP_015483633.1 polyprenyl synthetase family protein -
  NLK52_RS15685 (NLK52_15685) degQ 3036773..3036913 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NLK52_RS15690 (NLK52_15690) - 3037135..3037197 (+) 63 Protein_3034 hypothetical protein -
  NLK52_RS15695 (NLK52_15695) - 3037375..3037743 (+) 369 WP_015483634.1 hypothetical protein -
  NLK52_RS15700 (NLK52_15700) pdeH 3037719..3038948 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NLK52_RS15705 (NLK52_15705) pncB 3039085..3040557 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NLK52_RS15710 (NLK52_15710) pncA 3040573..3041124 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  NLK52_RS15715 (NLK52_15715) yueI 3041221..3041619 (-) 399 WP_015483635.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=705455 NLK52_RS15685 WP_003220708.1 3036773..3036913(-) (degQ) [Bacillus subtilis strain MEC_B298]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=705455 NLK52_RS15685 WP_003220708.1 3036773..3036913(-) (degQ) [Bacillus subtilis strain MEC_B298]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1