Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   M5C72_RS06190 Genome accession   NZ_CP099481
Coordinates   1236384..1236926 (+) Length   180 a.a.
NCBI ID   WP_076616433.1    Uniprot ID   A0A1P8Q4E0
Organism   Companilactobacillus allii strain WiKim39     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1219565..1270057 1236384..1236926 within 0


Gene organization within MGE regions


Location: 1219565..1270057
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M5C72_RS06080 (M5C72_06080) - 1219565..1220704 (-) 1140 WP_076616378.1 AI-2E family transporter -
  M5C72_RS06085 (M5C72_06085) galE 1220821..1221810 (-) 990 WP_076616381.1 UDP-glucose 4-epimerase GalE -
  M5C72_RS06090 (M5C72_06090) - 1221965..1222627 (+) 663 WP_076616384.1 class A sortase -
  M5C72_RS06095 (M5C72_06095) recJ 1222693..1224999 (+) 2307 WP_076616387.1 single-stranded-DNA-specific exonuclease RecJ -
  M5C72_RS06100 (M5C72_06100) - 1225021..1225539 (+) 519 WP_076616390.1 adenine phosphoribosyltransferase -
  M5C72_RS06110 (M5C72_06110) - 1225787..1226908 (-) 1122 WP_076616394.1 site-specific integrase -
  M5C72_RS06115 (M5C72_06115) - 1227050..1227901 (-) 852 WP_076616397.1 SHOCT domain-containing protein -
  M5C72_RS06120 (M5C72_06120) - 1227958..1228368 (-) 411 WP_076618862.1 ImmA/IrrE family metallo-endopeptidase -
  M5C72_RS06125 (M5C72_06125) - 1228389..1229342 (-) 954 WP_076616400.1 minor capsid protein -
  M5C72_RS06130 (M5C72_06130) - 1229332..1229676 (-) 345 WP_076616403.1 helix-turn-helix domain-containing protein -
  M5C72_RS06135 (M5C72_06135) - 1229934..1230143 (+) 210 WP_076616406.1 helix-turn-helix transcriptional regulator -
  M5C72_RS06140 (M5C72_06140) - 1230154..1230942 (+) 789 WP_076616408.1 phage antirepressor -
  M5C72_RS06145 (M5C72_06145) - 1230946..1231278 (+) 333 WP_076616411.1 DUF771 domain-containing protein -
  M5C72_RS06150 (M5C72_06150) - 1231272..1231445 (+) 174 WP_157886447.1 hypothetical protein -
  M5C72_RS06155 (M5C72_06155) - 1231585..1232091 (-) 507 WP_076616414.1 hypothetical protein -
  M5C72_RS06160 (M5C72_06160) - 1232379..1233290 (+) 912 WP_076616420.1 DUF1351 domain-containing protein -
  M5C72_RS06165 (M5C72_06165) - 1233287..1233931 (+) 645 WP_076616424.1 ERF family protein -
  M5C72_RS06170 (M5C72_06170) - 1233943..1234599 (+) 657 WP_083685969.1 putative HNHc nuclease -
  M5C72_RS06175 (M5C72_06175) - 1234602..1235330 (+) 729 WP_076616426.1 helix-turn-helix domain-containing protein -
  M5C72_RS06180 (M5C72_06180) - 1235355..1236116 (+) 762 WP_225972247.1 AAA family ATPase -
  M5C72_RS06185 (M5C72_06185) - 1236119..1236394 (+) 276 WP_076616431.1 hypothetical protein -
  M5C72_RS06190 (M5C72_06190) ssb 1236384..1236926 (+) 543 WP_076616433.1 single-stranded DNA-binding protein Machinery gene
  M5C72_RS06195 (M5C72_06195) - 1236944..1237384 (+) 441 WP_076616435.1 replication terminator protein -
  M5C72_RS06200 (M5C72_06200) - 1237398..1237583 (+) 186 WP_076616438.1 hypothetical protein -
  M5C72_RS06205 (M5C72_06205) - 1237595..1237810 (+) 216 WP_076616442.1 hypothetical protein -
  M5C72_RS06210 (M5C72_06210) - 1237803..1238021 (+) 219 WP_076616445.1 hypothetical protein -
  M5C72_RS06215 (M5C72_06215) - 1238063..1238470 (+) 408 WP_225972195.1 transcriptional regulator -
  M5C72_RS06220 (M5C72_06220) - 1238669..1239346 (+) 678 WP_076616454.1 hypothetical protein -
  M5C72_RS06225 (M5C72_06225) - 1239374..1240156 (+) 783 WP_076616457.1 terminase small subunit -
  M5C72_RS06230 (M5C72_06230) - 1240137..1241396 (+) 1260 WP_076616461.1 phage terminase large subunit -
  M5C72_RS06235 (M5C72_06235) - 1241387..1242799 (+) 1413 WP_076616464.1 phage portal protein -
  M5C72_RS06240 (M5C72_06240) - 1242786..1244822 (+) 2037 WP_076616466.1 minor capsid protein -
  M5C72_RS06245 (M5C72_06245) - 1244815..1244973 (+) 159 WP_164510771.1 hypothetical protein -
  M5C72_RS06250 (M5C72_06250) - 1245101..1245652 (+) 552 WP_076616469.1 phage scaffolding protein -
  M5C72_RS06255 (M5C72_06255) - 1245668..1246582 (+) 915 WP_076616471.1 capsid protein -
  M5C72_RS06260 (M5C72_06260) - 1246658..1247113 (+) 456 WP_076616474.1 Ig-like domain-containing protein -
  M5C72_RS06265 (M5C72_06265) - 1247123..1247512 (+) 390 WP_076616476.1 hypothetical protein -
  M5C72_RS06270 (M5C72_06270) - 1247530..1247886 (+) 357 WP_076618867.1 hypothetical protein -
  M5C72_RS06275 (M5C72_06275) - 1247887..1248309 (+) 423 WP_076616479.1 HK97 gp10 family phage protein -
  M5C72_RS06280 (M5C72_06280) - 1248306..1248713 (+) 408 WP_076616482.1 DUF6838 family protein -
  M5C72_RS06285 (M5C72_06285) - 1248703..1248858 (+) 156 WP_157886448.1 hypothetical protein -
  M5C72_RS06290 (M5C72_06290) - 1248858..1250276 (+) 1419 WP_076616485.1 phage tail sheath family protein -
  M5C72_RS06295 (M5C72_06295) - 1250292..1250777 (+) 486 WP_076616488.1 phage tail tube protein -
  M5C72_RS06300 (M5C72_06300) - 1250820..1251209 (+) 390 WP_076616491.1 hypothetical protein -
  M5C72_RS06305 (M5C72_06305) - 1251254..1251403 (+) 150 WP_164510772.1 hypothetical protein -
  M5C72_RS06310 (M5C72_06310) - 1251440..1254559 (+) 3120 WP_076616494.1 tape measure protein -
  M5C72_RS06315 (M5C72_06315) - 1254570..1255256 (+) 687 WP_076616498.1 hypothetical protein -
  M5C72_RS06320 (M5C72_06320) - 1255253..1256305 (+) 1053 WP_076616501.1 hypothetical protein -
  M5C72_RS06325 (M5C72_06325) - 1256278..1256646 (+) 369 WP_076616504.1 DUF2577 domain-containing protein -
  M5C72_RS06330 (M5C72_06330) - 1256639..1256998 (+) 360 WP_076616507.1 DUF2634 domain-containing protein -
  M5C72_RS06335 (M5C72_06335) - 1256988..1258136 (+) 1149 WP_076616509.1 baseplate J/gp47 family protein -
  M5C72_RS06340 (M5C72_06340) - 1258129..1258923 (+) 795 WP_076616512.1 putative phage tail protein -
  M5C72_RS06345 (M5C72_06345) - 1258924..1259508 (+) 585 WP_076616515.1 phage tail protein -
  M5C72_RS06350 (M5C72_06350) - 1259511..1259786 (+) 276 WP_076616518.1 hypothetical protein -
  M5C72_RS06355 (M5C72_06355) - 1259800..1261029 (+) 1230 WP_076616521.1 hypothetical protein -
  M5C72_RS06360 (M5C72_06360) - 1261042..1261383 (+) 342 WP_076616523.1 hypothetical protein -
  M5C72_RS06365 (M5C72_06365) - 1261383..1261517 (+) 135 WP_083685972.1 XkdX family protein -
  M5C72_RS06370 (M5C72_06370) - 1261554..1261940 (+) 387 WP_083685973.1 hypothetical protein -
  M5C72_RS06375 (M5C72_06375) - 1261933..1262226 (+) 294 WP_076616526.1 hypothetical protein -
  M5C72_RS06380 (M5C72_06380) - 1262227..1262517 (+) 291 WP_076616530.1 holin -
  M5C72_RS06385 (M5C72_06385) - 1262514..1263635 (+) 1122 WP_076616533.1 GH25 family lysozyme -
  M5C72_RS06390 (M5C72_06390) relB 1264098..1264316 (-) 219 WP_076616536.1 type II toxin-antitoxin system RelB family antitoxin -
  M5C72_RS06395 (M5C72_06395) - 1264533..1264985 (+) 453 WP_076616540.1 MarR family transcriptional regulator -
  M5C72_RS06400 (M5C72_06400) - 1265004..1265525 (+) 522 WP_076616543.1 GNAT family N-acetyltransferase -
  M5C72_RS06405 (M5C72_06405) map 1265629..1266414 (+) 786 WP_076616547.1 type I methionyl aminopeptidase -
  M5C72_RS06410 (M5C72_06410) - 1266480..1267100 (-) 621 WP_083685974.1 hypothetical protein -
  M5C72_RS06415 (M5C72_06415) - 1267141..1267653 (-) 513 WP_076616550.1 SLAP domain-containing protein -
  M5C72_RS06420 (M5C72_06420) - 1268039..1268464 (+) 426 WP_076616554.1 universal stress protein -
  M5C72_RS06425 (M5C72_06425) - 1268485..1268793 (-) 309 WP_076616557.1 hypothetical protein -
  M5C72_RS06430 (M5C72_06430) - 1268862..1269386 (-) 525 WP_076616561.1 phosphatidylglycerophosphatase A -
  M5C72_RS06435 (M5C72_06435) - 1269401..1270057 (-) 657 WP_076616564.1 HD domain-containing protein -

Sequence


Protein


Download         Length: 180 a.a.        Molecular weight: 20362.95 Da        Isoelectric Point: 5.8919

>NTDB_id=699940 M5C72_RS06190 WP_076616433.1 1236384..1236926(+) (ssb) [Companilactobacillus allii strain WiKim39]
MLNKCVLVGRLTKDVELRYTNNNDAAANFIIAVNRNFKNAQGEREADFINCVIWRKAAEIFSKYTHKGSLVAIDGRIQTR
TYDNNQGQTVYVTELLVDEFSFLDSNNSDSNQSNNNNSQQRFNRNNSQNSNNYQNNNQSQFGNNSPFENGRQNNNAGNGM
NDPYKSNNGGINVSDDQLPF

Nucleotide


Download         Length: 543 bp        

>NTDB_id=699940 M5C72_RS06190 WP_076616433.1 1236384..1236926(+) (ssb) [Companilactobacillus allii strain WiKim39]
ATGCTGAATAAGTGTGTTTTAGTCGGACGATTAACTAAGGATGTTGAACTTAGATACACGAATAACAATGATGCTGCAGC
AAATTTTATAATTGCGGTTAATCGAAACTTTAAGAATGCTCAAGGTGAACGTGAGGCAGATTTTATTAACTGTGTTATTT
GGAGGAAAGCAGCTGAAATATTCAGTAAATATACTCACAAGGGTTCATTAGTGGCAATTGATGGTAGGATTCAAACACGA
ACTTACGATAATAATCAAGGTCAGACTGTTTATGTTACCGAGTTGCTCGTAGATGAGTTTTCATTTTTGGATTCAAATAA
TTCTGATAGTAACCAATCTAATAATAATAACAGCCAACAAAGATTTAATCGTAATAATTCTCAAAATAGCAATAATTACC
AAAATAATAATCAATCGCAATTTGGGAATAATAGTCCATTTGAAAATGGTCGTCAGAACAATAATGCTGGTAATGGTATG
AATGATCCATATAAATCAAATAATGGTGGGATAAATGTCAGCGATGATCAGTTGCCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1P8Q4E0

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

52.222

100

0.522

  ssbA Bacillus subtilis subsp. subtilis str. 168

47.283

100

0.483