Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   NG745_RS01995 Genome accession   NZ_CP099465
Coordinates   397718..397837 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain Ag75     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 392718..402837
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NG745_RS01980 (NG745_01980) - 394330..395013 (+) 684 WP_063096183.1 response regulator transcription factor -
  NG745_RS01985 (NG745_01985) - 395000..396433 (+) 1434 WP_162992601.1 HAMP domain-containing sensor histidine kinase -
  NG745_RS01990 (NG745_01990) rapC 396586..397734 (+) 1149 WP_098080978.1 Rap family tetratricopeptide repeat protein Regulator
  NG745_RS01995 (NG745_01995) phrC 397718..397837 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  NG745_RS02000 (NG745_02000) - 397986..398081 (-) 96 WP_021495118.1 YjcZ family sporulation protein -
  NG745_RS02005 (NG745_02005) - 398176..399540 (-) 1365 WP_080130839.1 aspartate kinase -
  NG745_RS02010 (NG745_02010) ceuB 399954..400907 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  NG745_RS02015 (NG745_02015) - 400897..401844 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  NG745_RS02020 (NG745_02020) - 401838..402596 (+) 759 WP_063096189.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=699844 NG745_RS01995 WP_003156334.1 397718..397837(+) (phrC) [Bacillus velezensis strain Ag75]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=699844 NG745_RS01995 WP_003156334.1 397718..397837(+) (phrC) [Bacillus velezensis strain Ag75]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718