Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   NF199_RS11745 Genome accession   NZ_CP099460
Coordinates   2439609..2439923 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain E     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2434609..2444923
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NF199_RS11700 sinI 2435290..2435463 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  NF199_RS11705 sinR 2435497..2435832 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NF199_RS11710 tasA 2435880..2436665 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  NF199_RS11715 sipW 2436730..2437314 (-) 585 WP_032874025.1 signal peptidase I SipW -
  NF199_RS11720 tapA 2437286..2437957 (-) 672 WP_265605828.1 amyloid fiber anchoring/assembly protein TapA -
  NF199_RS11725 - 2438216..2438545 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  NF199_RS11730 - 2438586..2438765 (-) 180 WP_022552966.1 YqzE family protein -
  NF199_RS11735 comGG 2438822..2439199 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  NF199_RS11740 comGF 2439200..2439664 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  NF199_RS11745 comGE 2439609..2439923 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  NF199_RS11750 comGD 2439907..2440344 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  NF199_RS11755 comGC 2440334..2440600 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  NF199_RS11760 comGB 2440647..2441684 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  NF199_RS11765 comGA 2441671..2442741 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  NF199_RS11770 - 2442938..2443888 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=699787 NF199_RS11745 WP_032874016.1 2439609..2439923(-) (comGE) [Bacillus velezensis strain E]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=699787 NF199_RS11745 WP_032874016.1 2439609..2439923(-) (comGE) [Bacillus velezensis strain E]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481