Detailed information    

insolico Bioinformatically predicted

Overview


Name   comE   Type   Machinery gene
Locus tag   NDQ64_RS08480 Genome accession   NZ_CP098544
Coordinates   1612607..1613002 (-) Length   131 a.a.
NCBI ID   WP_003703428.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 10296     
Function   DNA binding (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1579789..1611821 1612607..1613002 flank 786


Gene organization within MGE regions


Location: 1579789..1613002
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDQ64_RS08225 (NDQ64_08130) - 1579817..1580791 (-) 975 WP_003689550.1 SIS domain-containing protein -
  NDQ64_RS08230 (NDQ64_08135) tal 1580888..1581943 (+) 1056 WP_003695503.1 transaldolase -
  NDQ64_RS08235 - 1581955..1582089 (+) 135 WP_012503902.1 hypothetical protein -
  NDQ64_RS08240 (NDQ64_08140) - 1582094..1582384 (+) 291 WP_003689553.1 hypothetical protein -
  NDQ64_RS08245 (NDQ64_08145) gluQRS 1582401..1583288 (+) 888 WP_003689554.1 tRNA glutamyl-Q(34) synthetase GluQRS -
  NDQ64_RS08250 (NDQ64_08150) dusA 1583358..1584374 (-) 1017 WP_003689555.1 tRNA dihydrouridine(20/20a) synthase DusA -
  NDQ64_RS08255 (NDQ64_08155) - 1584494..1585648 (+) 1155 WP_003693486.1 tyrosine-type recombinase/integrase -
  NDQ64_RS08260 (NDQ64_08160) - 1585698..1585964 (-) 267 WP_003689557.1 pyocin activator PrtN family protein -
  NDQ64_RS08265 (NDQ64_08165) - 1586072..1587220 (-) 1149 WP_003705649.1 hypothetical protein -
  NDQ64_RS08270 (NDQ64_08170) - 1587217..1588200 (-) 984 WP_260244315.1 hypothetical protein -
  NDQ64_RS08275 (NDQ64_08175) - 1588311..1588526 (-) 216 WP_003691538.1 hypothetical protein -
  NDQ64_RS08280 (NDQ64_08180) - 1588578..1589069 (-) 492 WP_047918703.1 siphovirus Gp157 family protein -
  NDQ64_RS08285 (NDQ64_08185) - 1589066..1589248 (-) 183 WP_003691535.1 hypothetical protein -
  NDQ64_RS08290 (NDQ64_08190) - 1589388..1590074 (-) 687 WP_010951053.1 phage replication initiation protein, NGO0469 family -
  NDQ64_RS08295 (NDQ64_08195) - 1590143..1590304 (-) 162 WP_003702497.1 hypothetical protein -
  NDQ64_RS08300 (NDQ64_08200) - 1590301..1590579 (-) 279 WP_003691529.1 NGO1622 family putative holin -
  NDQ64_RS08305 (NDQ64_08205) - 1590732..1591064 (-) 333 WP_003687946.1 hypothetical protein -
  NDQ64_RS08310 (NDQ64_08210) - 1591205..1591510 (-) 306 WP_260244314.1 hypothetical protein -
  NDQ64_RS08315 (NDQ64_08215) - 1591507..1591983 (-) 477 WP_012504141.1 DUF6948 domain-containing protein -
  NDQ64_RS08320 (NDQ64_08220) - 1592016..1592216 (-) 201 WP_003704298.1 hypothetical protein -
  NDQ64_RS08325 (NDQ64_08225) - 1592700..1592918 (+) 219 WP_003691731.1 hypothetical protein -
  NDQ64_RS08330 (NDQ64_08230) - 1592935..1593294 (-) 360 WP_003691733.1 hypothetical protein -
  NDQ64_RS08335 (NDQ64_08235) - 1593295..1593834 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  NDQ64_RS08340 (NDQ64_08240) - 1593994..1594710 (-) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  NDQ64_RS08345 (NDQ64_08245) - 1595091..1595318 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  NDQ64_RS08350 (NDQ64_08250) - 1595436..1596500 (+) 1065 WP_003689134.1 hypothetical protein -
  NDQ64_RS08355 (NDQ64_08255) - 1596497..1597858 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  NDQ64_RS08360 (NDQ64_08260) - 1597875..1598105 (+) 231 WP_012503490.1 hypothetical protein -
  NDQ64_RS08365 (NDQ64_08265) - 1598196..1598690 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  NDQ64_RS08370 (NDQ64_08270) - 1599074..1599223 (+) 150 WP_106278816.1 hypothetical protein -
  NDQ64_RS08375 (NDQ64_08275) - 1599252..1599533 (+) 282 WP_003689109.1 hypothetical protein -
  NDQ64_RS08380 (NDQ64_08280) - 1599524..1599904 (+) 381 WP_033910829.1 RusA family crossover junction endodeoxyribonuclease -
  NDQ64_RS08385 - 1599921..1600049 (-) 129 WP_012503747.1 hypothetical protein -
  NDQ64_RS08390 (NDQ64_08285) - 1600233..1601195 (-) 963 WP_057330785.1 IS110 family transposase -
  NDQ64_RS08395 (NDQ64_08290) - 1601708..1602067 (-) 360 WP_003689732.1 hypothetical protein -
  NDQ64_RS08400 (NDQ64_08295) - 1602188..1603260 (-) 1073 Protein_1627 zonular occludens toxin domain-containing protein -
  NDQ64_RS08405 (NDQ64_08300) - 1603270..1603560 (-) 291 WP_012503936.1 DUF2523 domain-containing protein -
  NDQ64_RS08410 (NDQ64_08305) - 1603539..1605128 (-) 1590 WP_260244331.1 IgG-binding virulence factor TspB family protein -
  NDQ64_RS08415 (NDQ64_08310) - 1605070..1605387 (-) 318 WP_003689167.1 DUF1132 family protein -
  NDQ64_RS08420 (NDQ64_08315) - 1605515..1605793 (-) 279 WP_003691583.1 hypothetical protein -
  NDQ64_RS08425 (NDQ64_08320) - 1605800..1606018 (-) 219 WP_003691584.1 major capsid protein -
  NDQ64_RS08430 (NDQ64_08325) - 1606092..1606289 (-) 198 WP_003689600.1 hypothetical protein -
  NDQ64_RS08435 (NDQ64_08330) - 1606294..1606584 (-) 291 WP_012503914.1 hypothetical protein -
  NDQ64_RS08440 (NDQ64_08335) - 1606629..1607978 (-) 1350 WP_025455830.1 replication initiation factor domain-containing protein -
  NDQ64_RS08445 (NDQ64_08340) - 1608117..1608539 (-) 423 WP_003691751.1 very short patch repair endonuclease -
  NDQ64_RS08450 (NDQ64_08345) - 1608545..1609141 (-) 597 WP_012503916.1 TIGR02391 family protein -
  NDQ64_RS08455 (NDQ64_08350) - 1609331..1610188 (-) 858 WP_012503917.1 ATP-binding protein -
  NDQ64_RS08460 (NDQ64_08355) - 1610202..1610573 (-) 372 WP_012503918.1 DNA cytosine methyltransferase -
  NDQ64_RS08465 (NDQ64_08360) - 1610570..1611178 (-) 609 WP_080229275.1 DNA cytosine methyltransferase -
  NDQ64_RS08470 (NDQ64_08365) - 1611547..1611693 (+) 147 WP_003691757.1 hypothetical protein -
  NDQ64_RS08475 (NDQ64_08370) comP 1612070..1612519 (-) 450 WP_002214937.1 type IV pilin protein Machinery gene
  NDQ64_RS08480 (NDQ64_08375) comE 1612607..1613002 (-) 396 WP_003703428.1 helix-hairpin-helix domain-containing protein Machinery gene

Sequence


Protein


Download         Length: 131 a.a.        Molecular weight: 13796.61 Da        Isoelectric Point: 10.8790

>NTDB_id=696886 NDQ64_RS08480 WP_003703428.1 1612607..1613002(-) (comE) [Neisseria gonorrhoeae strain 10296]
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK

Nucleotide


Download         Length: 396 bp        

>NTDB_id=696886 NDQ64_RS08480 WP_003703428.1 1612607..1613002(-) (comE) [Neisseria gonorrhoeae strain 10296]
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG

Domains


Predicted by InterproScan.

(52-110)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comE Neisseria gonorrhoeae MS11

100

100

1

  comE Neisseria gonorrhoeae MS11

100

100

1

  comE Neisseria gonorrhoeae MS11

100

100

1

  comE Neisseria gonorrhoeae MS11

100

100

1