Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NDK36_RS16265 Genome accession   NZ_CP098491
Coordinates   3027139..3027279 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain NB205     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3022139..3032279
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDK36_RS16240 (NDK36_16240) yuxO 3022416..3022796 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  NDK36_RS16245 (NDK36_16245) comA 3022815..3023459 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NDK36_RS16250 (NDK36_16250) comP 3023540..3025852 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  NDK36_RS16255 (NDK36_16255) comX 3025868..3026089 (-) 222 WP_014480704.1 competence pheromone ComX -
  NDK36_RS16260 (NDK36_16260) - 3026091..3026954 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  NDK36_RS16265 (NDK36_16265) degQ 3027139..3027279 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NDK36_RS16270 (NDK36_16270) - 3027501..3027626 (+) 126 WP_003228793.1 hypothetical protein -
  NDK36_RS16275 (NDK36_16275) - 3027740..3028108 (+) 369 WP_014477834.1 hypothetical protein -
  NDK36_RS16280 (NDK36_16280) pdeH 3028084..3029313 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  NDK36_RS16285 (NDK36_16285) pncB 3029449..3030921 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  NDK36_RS16290 (NDK36_16290) pncA 3030937..3031488 (-) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  NDK36_RS16295 (NDK36_16295) yueI 3031585..3031983 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=696315 NDK36_RS16265 WP_003220708.1 3027139..3027279(-) (degQ) [Bacillus subtilis strain NB205]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=696315 NDK36_RS16265 WP_003220708.1 3027139..3027279(-) (degQ) [Bacillus subtilis strain NB205]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1