Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NDK36_RS12750 Genome accession   NZ_CP098491
Coordinates   2368809..2369192 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain NB205     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2363809..2374192
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDK36_RS12710 (NDK36_12710) sinI 2364743..2364916 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NDK36_RS12715 (NDK36_12715) sinR 2364950..2365285 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NDK36_RS12720 (NDK36_12720) tasA 2365378..2366163 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  NDK36_RS12725 (NDK36_12725) sipW 2366227..2366799 (-) 573 WP_003230181.1 signal peptidase I SipW -
  NDK36_RS12730 (NDK36_12730) tapA 2366783..2367544 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  NDK36_RS12735 (NDK36_12735) yqzG 2367816..2368142 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NDK36_RS12740 (NDK36_12740) spoIITA 2368184..2368363 (-) 180 WP_014480252.1 YqzE family protein -
  NDK36_RS12745 (NDK36_12745) comGG 2368434..2368808 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NDK36_RS12750 (NDK36_12750) comGF 2368809..2369192 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  NDK36_RS12755 (NDK36_12755) comGE 2369218..2369565 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  NDK36_RS12760 (NDK36_12760) comGD 2369549..2369980 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  NDK36_RS12765 (NDK36_12765) comGC 2369970..2370266 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NDK36_RS12770 (NDK36_12770) comGB 2370280..2371317 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  NDK36_RS12775 (NDK36_12775) comGA 2371304..2372374 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NDK36_RS12780 (NDK36_12780) - 2372586..2372783 (-) 198 WP_014480259.1 CBS domain-containing protein -
  NDK36_RS12785 (NDK36_12785) corA 2372785..2373738 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=696294 NDK36_RS12750 WP_014480254.1 2368809..2369192(-) (comGF) [Bacillus subtilis strain NB205]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=696294 NDK36_RS12750 WP_014480254.1 2368809..2369192(-) (comGF) [Bacillus subtilis strain NB205]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984