Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NDK36_RS12710 Genome accession   NZ_CP098491
Coordinates   2364743..2364916 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain NB205     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2359743..2369916
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NDK36_RS12695 (NDK36_12695) gcvT 2360542..2361630 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  NDK36_RS12700 (NDK36_12700) hepAA 2362072..2363745 (+) 1674 WP_014480248.1 SNF2-related protein -
  NDK36_RS12705 (NDK36_12705) yqhG 2363766..2364560 (+) 795 WP_014480249.1 YqhG family protein -
  NDK36_RS12710 (NDK36_12710) sinI 2364743..2364916 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NDK36_RS12715 (NDK36_12715) sinR 2364950..2365285 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NDK36_RS12720 (NDK36_12720) tasA 2365378..2366163 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  NDK36_RS12725 (NDK36_12725) sipW 2366227..2366799 (-) 573 WP_003230181.1 signal peptidase I SipW -
  NDK36_RS12730 (NDK36_12730) tapA 2366783..2367544 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  NDK36_RS12735 (NDK36_12735) yqzG 2367816..2368142 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NDK36_RS12740 (NDK36_12740) spoIITA 2368184..2368363 (-) 180 WP_014480252.1 YqzE family protein -
  NDK36_RS12745 (NDK36_12745) comGG 2368434..2368808 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NDK36_RS12750 (NDK36_12750) comGF 2368809..2369192 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  NDK36_RS12755 (NDK36_12755) comGE 2369218..2369565 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=696291 NDK36_RS12710 WP_003230187.1 2364743..2364916(+) (sinI) [Bacillus subtilis strain NB205]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=696291 NDK36_RS12710 WP_003230187.1 2364743..2364916(+) (sinI) [Bacillus subtilis strain NB205]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1