Detailed information
Overview
| Name | comE | Type | Machinery gene |
| Locus tag | NC855_RS08045 | Genome accession | NZ_CP098472 |
| Coordinates | 1541161..1541556 (-) | Length | 131 a.a. |
| NCBI ID | WP_003703428.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 10612 | ||
| Function | DNA binding (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1507124..1540375 | 1541161..1541556 | flank | 786 |
Gene organization within MGE regions
Location: 1507124..1541556
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NC855_RS07775 (NC855_07700) | - | 1507152..1508126 (-) | 975 | WP_003689550.1 | SIS domain-containing protein | - |
| NC855_RS07780 (NC855_07705) | tal | 1508223..1509278 (+) | 1056 | WP_003689551.1 | transaldolase | - |
| NC855_RS07785 (NC855_11815) | - | 1509290..1509424 (+) | 135 | WP_003703570.1 | hypothetical protein | - |
| NC855_RS07790 (NC855_07710) | - | 1509429..1509719 (+) | 291 | WP_003689553.1 | hypothetical protein | - |
| NC855_RS07795 (NC855_07715) | gluQRS | 1509736..1510623 (+) | 888 | WP_003693489.1 | tRNA glutamyl-Q(34) synthetase GluQRS | - |
| NC855_RS07800 (NC855_07720) | dusA | 1510693..1511709 (-) | 1017 | WP_003693487.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| NC855_RS07805 (NC855_07725) | - | 1511829..1512983 (+) | 1155 | WP_003693486.1 | tyrosine-type recombinase/integrase | - |
| NC855_RS07810 (NC855_07730) | - | 1513033..1513299 (-) | 267 | WP_003689557.1 | pyocin activator PrtN family protein | - |
| NC855_RS07815 (NC855_07735) | - | 1513407..1514555 (-) | 1149 | WP_134994054.1 | SAM-dependent methyltransferase | - |
| NC855_RS07820 (NC855_07740) | - | 1514552..1515535 (-) | 984 | WP_134994057.1 | hypothetical protein | - |
| NC855_RS07825 (NC855_07745) | - | 1515646..1515861 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| NC855_RS07830 (NC855_07750) | - | 1515913..1516404 (-) | 492 | WP_033911206.1 | siphovirus Gp157 family protein | - |
| NC855_RS07835 (NC855_07755) | - | 1516401..1516583 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| NC855_RS07840 (NC855_11820) | - | 1516723..1517409 (-) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| NC855_RS07845 (NC855_07770) | - | 1517478..1517639 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| NC855_RS07850 (NC855_07775) | - | 1517636..1517911 (-) | 276 | WP_151266294.1 | NGO1622 family putative holin | - |
| NC855_RS07855 (NC855_07780) | - | 1518064..1518396 (-) | 333 | WP_047923919.1 | hypothetical protein | - |
| NC855_RS11870 | - | 1518537..1518732 (-) | 196 | Protein_1530 | hypothetical protein | - |
| NC855_RS07860 (NC855_07785) | - | 1518942..1519703 (+) | 762 | WP_012503753.1 | hypothetical protein | - |
| NC855_RS07865 (NC855_07790) | - | 1519792..1520208 (-) | 417 | WP_003700378.1 | hypothetical protein | - |
| NC855_RS07870 (NC855_07795) | - | 1520217..1520801 (-) | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| NC855_RS07875 (NC855_07800) | - | 1520983..1521384 (-) | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| NC855_RS07880 (NC855_07805) | - | 1521486..1521668 (-) | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | - |
| NC855_RS07885 (NC855_07810) | - | 1521838..1522656 (-) | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| NC855_RS07890 (NC855_07815) | - | 1522931..1523686 (-) | 756 | WP_003693472.1 | S24 family peptidase | - |
| NC855_RS07895 (NC855_07820) | - | 1523823..1524008 (+) | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| NC855_RS07900 (NC855_07825) | - | 1524097..1524252 (+) | 156 | WP_003698902.1 | hypothetical protein | - |
| NC855_RS07905 (NC855_07830) | - | 1524229..1524417 (-) | 189 | WP_003691445.1 | hypothetical protein | - |
| NC855_RS07910 (NC855_07835) | - | 1524590..1524817 (+) | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| NC855_RS07915 (NC855_07840) | - | 1524814..1525824 (+) | 1011 | WP_229931731.1 | helix-turn-helix domain-containing protein | - |
| NC855_RS07920 (NC855_07845) | - | 1525839..1526618 (+) | 780 | WP_025455898.1 | ATP-binding protein | - |
| NC855_RS07925 (NC855_07850) | - | 1526688..1526918 (+) | 231 | WP_033911192.1 | hypothetical protein | - |
| NC855_RS07930 (NC855_07855) | - | 1526932..1527426 (+) | 495 | WP_003693463.1 | DUF3310 domain-containing protein | - |
| NC855_RS07935 (NC855_07860) | - | 1527621..1527770 (+) | 150 | WP_033911194.1 | phage associated protein | - |
| NC855_RS07940 (NC855_07865) | - | 1527798..1528079 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| NC855_RS07945 (NC855_07870) | - | 1528070..1528450 (+) | 381 | WP_033911195.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NC855_RS07950 (NC855_11825) | - | 1528467..1528595 (-) | 129 | WP_017147221.1 | hypothetical protein | - |
| NC855_RS07955 (NC855_07875) | - | 1528779..1529741 (-) | 963 | WP_050160654.1 | IS110 family transposase | - |
| NC855_RS07960 (NC855_07880) | - | 1530253..1530612 (-) | 360 | WP_003689732.1 | hypothetical protein | - |
| NC855_RS07965 (NC855_07885) | - | 1530733..1531818 (-) | 1086 | WP_003700139.1 | zonular occludens toxin domain-containing protein | - |
| NC855_RS07970 (NC855_07890) | - | 1531828..1532118 (-) | 291 | WP_003700141.1 | DUF2523 domain-containing protein | - |
| NC855_RS07975 (NC855_07895) | - | 1532119..1533684 (-) | 1566 | WP_167550560.1 | IgG-binding virulence factor TspB family protein | - |
| NC855_RS07980 (NC855_07900) | - | 1533626..1533943 (-) | 318 | WP_003689167.1 | DUF1132 family protein | - |
| NC855_RS07985 (NC855_07905) | - | 1534071..1534349 (-) | 279 | WP_003689168.1 | hypothetical protein | - |
| NC855_RS07990 (NC855_07910) | - | 1534356..1534574 (-) | 219 | WP_003691584.1 | major capsid protein | - |
| NC855_RS07995 (NC855_07915) | - | 1534648..1534845 (-) | 198 | WP_003689600.1 | hypothetical protein | - |
| NC855_RS08000 (NC855_07920) | - | 1534850..1535140 (-) | 291 | WP_002216601.1 | hypothetical protein | - |
| NC855_RS08005 (NC855_07925) | - | 1535185..1536532 (-) | 1348 | Protein_1560 | replication initiation factor domain-containing protein | - |
| NC855_RS08010 (NC855_07930) | - | 1536671..1537093 (-) | 423 | WP_003691751.1 | very short patch repair endonuclease | - |
| NC855_RS08015 (NC855_07935) | - | 1537099..1537695 (-) | 597 | WP_012503916.1 | TIGR02391 family protein | - |
| NC855_RS08020 (NC855_07940) | - | 1537885..1538742 (-) | 858 | WP_012503917.1 | ATP-binding protein | - |
| NC855_RS08025 (NC855_07945) | - | 1538756..1539127 (-) | 372 | WP_012503918.1 | DNA cytosine methyltransferase | - |
| NC855_RS08030 (NC855_07950) | - | 1539124..1539732 (-) | 609 | WP_080229275.1 | DNA cytosine methyltransferase | - |
| NC855_RS08035 (NC855_07955) | - | 1540101..1540247 (+) | 147 | WP_003691757.1 | hypothetical protein | - |
| NC855_RS08040 (NC855_07960) | comP | 1540624..1541073 (-) | 450 | WP_002214937.1 | type IV pilin protein | Machinery gene |
| NC855_RS08045 (NC855_07965) | comE | 1541161..1541556 (-) | 396 | WP_003703428.1 | helix-hairpin-helix domain-containing protein | Machinery gene |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 13796.61 Da Isoelectric Point: 10.8790
>NTDB_id=695991 NC855_RS08045 WP_003703428.1 1541161..1541556(-) (comE) [Neisseria gonorrhoeae strain 10612]
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK
Nucleotide
Download Length: 396 bp
>NTDB_id=695991 NC855_RS08045 WP_003703428.1 1541161..1541556(-) (comE) [Neisseria gonorrhoeae strain 10612]
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |