Detailed information
Bioinformatically predicted
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | NC855_RS02340 | Genome accession | NZ_CP098472 |
| Coordinates | 454195..454668 (+) | Length | 157 a.a. |
| NCBI ID | WP_172760650.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 10612 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 444513..493325 | 454195..454668 | within | 0 |
Gene organization within MGE regions
Location: 444513..493325
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NC855_RS02285 (NC855_02270) | - | 444513..445589 (-) | 1077 | WP_003692814.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| NC855_RS02290 (NC855_02275) | cysW | 445586..446446 (-) | 861 | WP_003699617.1 | sulfate ABC transporter permease subunit CysW | - |
| NC855_RS02295 (NC855_02280) | cysT | 446635..447462 (-) | 828 | WP_003699619.1 | sulfate ABC transporter permease subunit CysT | - |
| NC855_RS02300 (NC855_02285) | - | 447643..447975 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| NC855_RS02305 (NC855_02290) | - | 448302..448811 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| NC855_RS02310 (NC855_02295) | - | 449043..449624 (-) | 582 | WP_003690895.1 | superoxide dismutase | - |
| NC855_RS02315 (NC855_02300) | dnaB | 449788..451194 (+) | 1407 | WP_003699622.1 | replicative DNA helicase | - |
| NC855_RS02320 (NC855_02305) | pilH | 451348..452013 (+) | 666 | WP_003699624.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| NC855_RS02325 (NC855_02310) | pilV | 452045..452656 (+) | 612 | WP_003699626.1 | type IV pilus modification protein PilV | Machinery gene |
| NC855_RS02330 (NC855_02315) | pilJ | 452653..453603 (+) | 951 | WP_229433524.1 | PilW family protein | Machinery gene |
| NC855_RS02335 (NC855_02320) | pilK | 453582..454193 (+) | 612 | WP_229433526.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| NC855_RS02340 (NC855_02325) | pilL | 454195..454668 (+) | 474 | WP_172760650.1 | PilX family type IV pilin | Machinery gene |
| NC855_RS02345 (NC855_02330) | - | 454738..455046 (-) | 309 | WP_025456177.1 | AzlD family protein | - |
| NC855_RS02350 (NC855_02335) | - | 455043..455753 (-) | 711 | Protein_463 | AzlC family ABC transporter permease | - |
| NC855_RS02355 (NC855_02340) | dut | 455919..456371 (+) | 453 | WP_003699637.1 | dUTP diphosphatase | - |
| NC855_RS02360 (NC855_02345) | dapC | 456447..457634 (+) | 1188 | WP_003699639.1 | succinyldiaminopimelate transaminase | - |
| NC855_RS02365 (NC855_02350) | yaaA | 457790..458569 (+) | 780 | WP_003699641.1 | peroxide stress protein YaaA | - |
| NC855_RS02380 (NC855_02365) | - | 459099..460292 (+) | 1194 | WP_017146746.1 | tyrosine-type recombinase/integrase | - |
| NC855_RS02385 (NC855_02370) | - | 460648..460917 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| NC855_RS02390 (NC855_02375) | - | 461112..461795 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| NC855_RS11780 | - | 462076..462342 (-) | 267 | Protein_470 | hypothetical protein | - |
| NC855_RS02400 (NC855_02385) | - | 462453..462668 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| NC855_RS02405 (NC855_02390) | - | 462720..463211 (-) | 492 | WP_033911206.1 | siphovirus Gp157 family protein | - |
| NC855_RS02410 (NC855_02395) | - | 463208..463390 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| NC855_RS02415 (NC855_02400) | - | 463530..464216 (-) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| NC855_RS02420 (NC855_02405) | - | 464285..464446 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| NC855_RS02425 (NC855_02410) | - | 464443..464718 (-) | 276 | WP_151266294.1 | NGO1622 family putative holin | - |
| NC855_RS02430 (NC855_02415) | - | 464871..465203 (-) | 333 | WP_047923919.1 | hypothetical protein | - |
| NC855_RS02435 (NC855_02420) | - | 465461..465937 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| NC855_RS02440 (NC855_02425) | - | 465970..466170 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| NC855_RS02445 (NC855_02430) | - | 466368..466781 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| NC855_RS02450 (NC855_02435) | - | 466778..467239 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| NC855_RS02455 (NC855_02440) | - | 467256..467693 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| NC855_RS02460 (NC855_02445) | - | 467806..468522 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| NC855_RS02465 (NC855_02450) | - | 468597..468827 (+) | 231 | WP_020997318.1 | transcriptional regulator | - |
| NC855_RS02470 (NC855_02455) | - | 468907..469062 (+) | 156 | WP_003698902.1 | hypothetical protein | - |
| NC855_RS02475 (NC855_02460) | - | 469039..469227 (-) | 189 | WP_003691445.1 | hypothetical protein | - |
| NC855_RS02480 (NC855_02465) | - | 469400..469627 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| NC855_RS02485 (NC855_02470) | - | 470306..470809 (+) | 504 | WP_010360005.1 | hypothetical protein | - |
| NC855_RS02490 (NC855_02475) | - | 470806..472167 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| NC855_RS02495 (NC855_02480) | - | 472184..472435 (+) | 252 | WP_003703849.1 | hypothetical protein | - |
| NC855_RS02500 (NC855_02485) | - | 472449..472943 (+) | 495 | WP_047923539.1 | DUF3310 domain-containing protein | - |
| NC855_RS02505 (NC855_02490) | - | 473326..473475 (+) | 150 | WP_047920329.1 | phage associated protein | - |
| NC855_RS02510 (NC855_02495) | - | 473504..473785 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| NC855_RS02515 (NC855_02500) | - | 473776..474213 (+) | 438 | WP_229433529.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NC855_RS02520 (NC855_02505) | - | 474206..474511 (+) | 306 | WP_025456182.1 | DUF1364 domain-containing protein | - |
| NC855_RS02525 (NC855_02510) | - | 474508..474891 (+) | 384 | WP_003699764.1 | recombination protein NinB | - |
| NC855_RS02530 (NC855_02515) | - | 474882..475400 (+) | 519 | WP_003693459.1 | HNH endonuclease | - |
| NC855_RS02535 (NC855_02520) | - | 475465..475887 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| NC855_RS02540 (NC855_02525) | - | 475887..476426 (+) | 540 | WP_003693457.1 | hypothetical protein | - |
| NC855_RS02545 (NC855_02530) | - | 476407..477681 (+) | 1275 | WP_003698265.1 | PBSX family phage terminase large subunit | - |
| NC855_RS02550 (NC855_02535) | - | 477666..479933 (+) | 2268 | WP_229433533.1 | hypothetical protein | - |
| NC855_RS02555 (NC855_02540) | - | 480171..481367 (+) | 1197 | WP_003693452.1 | hypothetical protein | - |
| NC855_RS02560 (NC855_02545) | - | 481364..488671 (+) | 7308 | WP_003698268.1 | PLxRFG domain-containing protein | - |
| NC855_RS02565 (NC855_02550) | - | 489297..490592 (+) | 1296 | WP_003693441.1 | DUF4043 family protein | - |
| NC855_RS02570 (NC855_02555) | - | 490650..491123 (+) | 474 | WP_003693439.1 | hypothetical protein | - |
| NC855_RS02575 (NC855_02560) | - | 491129..491614 (+) | 486 | WP_003693438.1 | hypothetical protein | - |
| NC855_RS02580 (NC855_02565) | - | 491611..492285 (+) | 675 | WP_003693436.1 | hypothetical protein | - |
| NC855_RS02585 (NC855_02570) | - | 492288..492437 (+) | 150 | WP_017146863.1 | hypothetical protein | - |
| NC855_RS02590 (NC855_02575) | - | 492474..493325 (-) | 852 | WP_003699775.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17429.25 Da Isoelectric Point: 9.7225
>NTDB_id=695975 NC855_RS02340 WP_172760650.1 454195..454668(+) (pilL) [Neisseria gonorrhoeae strain 10612]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=695975 NC855_RS02340 WP_172760650.1 454195..454668(+) (pilL) [Neisseria gonorrhoeae strain 10612]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
91.083 |
100 |
0.911 |
| pilX | Neisseria meningitidis 8013 |
88.535 |
100 |
0.885 |