Detailed information
Bioinformatically predicted
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | NC854_RS02360 | Genome accession | NZ_CP098470 |
| Coordinates | 454461..454934 (+) | Length | 157 a.a. |
| NCBI ID | WP_172760650.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 10792 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 440131..506544 | 454461..454934 | within | 0 |
Gene organization within MGE regions
Location: 440131..506544
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NC854_RS02285 (NC854_02265) | - | 440131..441114 (+) | 984 | WP_003687900.1 | ribose-phosphate pyrophosphokinase | - |
| NC854_RS02290 (NC854_02270) | - | 441181..441753 (+) | 573 | WP_003687901.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| NC854_RS02295 (NC854_02275) | - | 441879..443048 (-) | 1170 | WP_003687902.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| NC854_RS02300 (NC854_02280) | ilvA | 443197..444723 (+) | 1527 | WP_003687904.1 | threonine ammonia-lyase, biosynthetic | - |
| NC854_RS02305 (NC854_02285) | - | 444779..445855 (-) | 1077 | WP_003692814.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| NC854_RS02310 (NC854_02290) | cysW | 445852..446712 (-) | 861 | WP_003699617.1 | sulfate ABC transporter permease subunit CysW | - |
| NC854_RS02315 (NC854_02295) | cysT | 446901..447728 (-) | 828 | WP_003699619.1 | sulfate ABC transporter permease subunit CysT | - |
| NC854_RS02320 (NC854_02300) | - | 447909..448241 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| NC854_RS02325 (NC854_02305) | - | 448568..449077 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| NC854_RS02330 (NC854_02310) | - | 449309..449890 (-) | 582 | WP_003690895.1 | superoxide dismutase | - |
| NC854_RS02335 (NC854_02315) | dnaB | 450054..451460 (+) | 1407 | WP_003699622.1 | replicative DNA helicase | - |
| NC854_RS02340 (NC854_02320) | pilH | 451614..452279 (+) | 666 | WP_003699624.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| NC854_RS02345 (NC854_02325) | pilV | 452311..452922 (+) | 612 | WP_003699626.1 | type IV pilus modification protein PilV | Machinery gene |
| NC854_RS02350 (NC854_02330) | pilJ | 452919..453869 (+) | 951 | WP_003699627.1 | PilW family protein | Machinery gene |
| NC854_RS02355 (NC854_02335) | pilK | 453848..454459 (+) | 612 | WP_033911077.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| NC854_RS02360 (NC854_02340) | pilL | 454461..454934 (+) | 474 | WP_172760650.1 | PilX family type IV pilin | Machinery gene |
| NC854_RS02365 (NC854_02345) | - | 455004..455312 (-) | 309 | WP_025456177.1 | AzlD family protein | - |
| NC854_RS02370 (NC854_02350) | - | 455309..456019 (-) | 711 | Protein_464 | AzlC family ABC transporter permease | - |
| NC854_RS02375 (NC854_02355) | dut | 456185..456637 (+) | 453 | WP_003699637.1 | dUTP diphosphatase | - |
| NC854_RS02380 (NC854_02360) | dapC | 456713..457900 (+) | 1188 | WP_003699639.1 | succinyldiaminopimelate transaminase | - |
| NC854_RS02385 (NC854_02365) | yaaA | 458056..458835 (+) | 780 | WP_003699641.1 | peroxide stress protein YaaA | - |
| NC854_RS02400 (NC854_02380) | - | 459365..460558 (+) | 1194 | WP_017146746.1 | phage integrase central domain-containing protein | - |
| NC854_RS02405 (NC854_02385) | - | 460914..461183 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| NC854_RS02410 (NC854_02390) | - | 461378..462061 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| NC854_RS11775 | - | 462342..462608 (-) | 267 | Protein_471 | hypothetical protein | - |
| NC854_RS02420 (NC854_02400) | - | 462719..462934 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| NC854_RS02425 (NC854_02405) | - | 462986..463477 (-) | 492 | WP_033911206.1 | siphovirus Gp157 family protein | - |
| NC854_RS02430 (NC854_02410) | - | 463474..463656 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| NC854_RS02435 (NC854_02415) | - | 463796..464482 (-) | 687 | WP_042758540.1 | phage replication initiation protein, NGO0469 family | - |
| NC854_RS02440 (NC854_02420) | - | 464551..464712 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| NC854_RS02445 (NC854_02425) | - | 464709..464987 (-) | 279 | WP_041421244.1 | NGO1622 family putative holin | - |
| NC854_RS02450 (NC854_02430) | - | 465140..465472 (-) | 333 | WP_003695500.1 | hypothetical protein | - |
| NC854_RS02455 (NC854_02435) | - | 465614..465889 (-) | 276 | WP_082285043.1 | hypothetical protein | - |
| NC854_RS02460 (NC854_02440) | - | 465886..466362 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| NC854_RS02465 (NC854_02445) | - | 466395..466595 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| NC854_RS02470 (NC854_02450) | - | 467079..467297 (+) | 219 | WP_003691731.1 | hypothetical protein | - |
| NC854_RS02475 (NC854_02455) | - | 467314..467673 (-) | 360 | WP_003691733.1 | hypothetical protein | - |
| NC854_RS02480 (NC854_02460) | - | 467674..468213 (-) | 540 | WP_003695998.1 | Panacea domain-containing protein | - |
| NC854_RS02485 (NC854_02465) | - | 468373..469089 (-) | 717 | WP_003695999.1 | helix-turn-helix transcriptional regulator | - |
| NC854_RS02490 (NC854_02470) | - | 469470..469697 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| NC854_RS02495 (NC854_02475) | - | 469815..470879 (+) | 1065 | WP_003689134.1 | hypothetical protein | - |
| NC854_RS02500 (NC854_02480) | - | 470876..472237 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| NC854_RS02505 (NC854_02485) | - | 472254..472484 (+) | 231 | WP_012503490.1 | hypothetical protein | - |
| NC854_RS02510 (NC854_02490) | - | 472576..473070 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| NC854_RS02515 (NC854_02495) | - | 473247..473396 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| NC854_RS02520 (NC854_02500) | - | 473424..473705 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| NC854_RS02525 (NC854_02505) | - | 473696..474076 (+) | 381 | WP_033911195.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NC854_RS02530 (NC854_11670) | - | 474093..474221 (-) | 129 | WP_012503747.1 | hypothetical protein | - |
| NC854_RS02535 (NC854_02510) | - | 474343..474750 (+) | 408 | WP_003691430.1 | hypothetical protein | - |
| NC854_RS02540 (NC854_02515) | - | 474841..476001 (+) | 1161 | WP_003691428.1 | type I restriction endonuclease | - |
| NC854_RS02545 (NC854_02520) | - | 476283..477152 (+) | 870 | WP_003700071.1 | BRO family protein | - |
| NC854_RS02550 (NC854_02525) | - | 477445..477894 (+) | 450 | WP_003689093.1 | hypothetical protein | - |
| NC854_RS02555 (NC854_02530) | terL | 477956..479377 (+) | 1422 | WP_003697216.1 | phage terminase large subunit | - |
| NC854_RS02560 (NC854_02535) | - | 479374..481521 (+) | 2148 | WP_003691423.1 | phage portal protein | - |
| NC854_RS02565 (NC854_02540) | - | 481589..482746 (+) | 1158 | WP_003700068.1 | hypothetical protein | - |
| NC854_RS02570 (NC854_02545) | - | 482787..484286 (+) | 1500 | WP_003691419.1 | hypothetical protein | - |
| NC854_RS02575 (NC854_02550) | - | 484293..484655 (+) | 363 | WP_003689082.1 | hypothetical protein | - |
| NC854_RS02580 (NC854_02555) | - | 484658..485188 (+) | 531 | WP_003689080.1 | head-tail connector protein | - |
| NC854_RS02585 (NC854_02560) | - | 485188..485670 (+) | 483 | WP_003706029.1 | HK97 gp10 family phage protein | - |
| NC854_RS02590 (NC854_02565) | - | 485667..486095 (+) | 429 | WP_003697213.1 | hypothetical protein | - |
| NC854_RS02595 (NC854_02570) | - | 486121..486894 (+) | 774 | WP_003691416.1 | hypothetical protein | - |
| NC854_RS02600 (NC854_02575) | - | 486956..487285 (+) | 330 | WP_003689072.1 | hypothetical protein | - |
| NC854_RS02605 (NC854_02580) | - | 487297..487563 (+) | 267 | WP_003692873.1 | hypothetical protein | - |
| NC854_RS02610 (NC854_02585) | - | 487563..488162 (+) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| NC854_RS02615 (NC854_02590) | - | 488159..489013 (+) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| NC854_RS02620 (NC854_02595) | - | 489015..489446 (+) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| NC854_RS02625 (NC854_02600) | - | 489474..489752 (-) | 279 | WP_003692877.1 | helix-turn-helix domain-containing protein | - |
| NC854_RS02630 (NC854_02605) | - | 489992..494137 (+) | 4146 | WP_025456199.1 | phage tail protein | - |
| NC854_RS02635 (NC854_02610) | - | 494249..494554 (+) | 306 | WP_003689058.1 | hypothetical protein | - |
| NC854_RS02640 (NC854_02615) | - | 494625..495095 (+) | 471 | WP_025455988.1 | hypothetical protein | - |
| NC854_RS02645 (NC854_02620) | - | 495096..495428 (+) | 333 | WP_003691408.1 | hypothetical protein | - |
| NC854_RS02650 (NC854_02625) | - | 495796..496143 (-) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| NC854_RS02655 (NC854_02630) | - | 496143..496379 (-) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| NC854_RS02660 (NC854_11675) | - | 496419..496544 (+) | 126 | WP_255294325.1 | hypothetical protein | - |
| NC854_RS02665 (NC854_02635) | - | 496586..497125 (+) | 540 | WP_047951643.1 | TIGR02594 family protein | - |
| NC854_RS02670 (NC854_02640) | - | 497125..497283 (+) | 159 | WP_003691816.1 | hypothetical protein | - |
| NC854_RS02675 (NC854_02645) | - | 497267..497608 (+) | 342 | WP_003700102.1 | hypothetical protein | - |
| NC854_RS02680 (NC854_02650) | - | 497592..497765 (+) | 174 | WP_003705498.1 | hypothetical protein | - |
| NC854_RS02685 (NC854_02655) | - | 498077..498226 (+) | 150 | WP_003691402.1 | hypothetical protein | - |
| NC854_RS02690 (NC854_02660) | - | 498256..501300 (+) | 3045 | WP_229930235.1 | tape measure protein | - |
| NC854_RS02695 (NC854_02665) | - | 501360..501839 (-) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| NC854_RS02700 (NC854_02670) | - | 502181..503170 (-) | 990 | WP_003689040.1 | site-specific integrase | - |
| NC854_RS02705 (NC854_02675) | - | 503430..503618 (-) | 189 | WP_003689039.1 | hypothetical protein | - |
| NC854_RS02710 (NC854_02680) | purM | 503859..504893 (+) | 1035 | WP_003692893.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| NC854_RS02715 (NC854_02685) | - | 505891..506544 (+) | 654 | WP_134994130.1 | IS1595 family transposase | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17429.25 Da Isoelectric Point: 9.7225
>NTDB_id=695925 NC854_RS02360 WP_172760650.1 454461..454934(+) (pilL) [Neisseria gonorrhoeae strain 10792]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=695925 NC854_RS02360 WP_172760650.1 454461..454934(+) (pilL) [Neisseria gonorrhoeae strain 10792]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
91.083 |
100 |
0.911 |
| pilX | Neisseria meningitidis 8013 |
88.535 |
100 |
0.885 |