Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NCL52_RS15915 Genome accession   NZ_CP098417
Coordinates   3087266..3087406 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain N2-10     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3082266..3092406
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NCL52_RS15890 (NCL52_15890) yuxO 3082542..3082922 (-) 381 WP_071579112.1 hotdog fold thioesterase -
  NCL52_RS15895 (NCL52_15895) comA 3082941..3083585 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NCL52_RS15900 (NCL52_15900) - 3083666..3085978 (-) 2313 Protein_3074 histidine kinase -
  NCL52_RS15905 (NCL52_15905) comX 3085994..3086215 (-) 222 WP_134982027.1 competence pheromone ComX -
  NCL52_RS15910 (NCL52_15910) - 3086212..3087081 (-) 870 WP_251107045.1 polyprenyl synthetase family protein -
  NCL52_RS15915 (NCL52_15915) degQ 3087266..3087406 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NCL52_RS15920 (NCL52_15920) - 3087628..3087753 (+) 126 WP_128473219.1 hypothetical protein -
  NCL52_RS15925 (NCL52_15925) - 3087869..3088237 (+) 369 WP_017695529.1 hypothetical protein -
  NCL52_RS15930 (NCL52_15930) pdeH 3088213..3089442 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  NCL52_RS15935 (NCL52_15935) pncB 3089579..3091051 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NCL52_RS15940 (NCL52_15940) pncA 3091067..3091618 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  NCL52_RS15945 (NCL52_15945) yueI 3091715..3092113 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=695405 NCL52_RS15915 WP_003220708.1 3087266..3087406(-) (degQ) [Bacillus subtilis strain N2-10]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=695405 NCL52_RS15915 WP_003220708.1 3087266..3087406(-) (degQ) [Bacillus subtilis strain N2-10]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1