Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   NBT14_RS05885 Genome accession   NZ_CP098365
Coordinates   1213973..1214500 (-) Length   175 a.a.
NCBI ID   WP_164223991.1    Uniprot ID   -
Organism   Weissella paramesenteroides strain LCW-28     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1183995..1228158 1213973..1214500 within 0


Gene organization within MGE regions


Location: 1183995..1228158
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NBT14_RS05700 (NBT14_05680) - 1183995..1185098 (-) 1104 WP_404975354.1 GH25 family lysozyme -
  NBT14_RS05705 (NBT14_05685) - 1185189..1185393 (-) 205 Protein_1071 phage holin -
  NBT14_RS05710 (NBT14_05690) - 1185410..1185643 (-) 234 WP_404975355.1 hypothetical protein -
  NBT14_RS05715 (NBT14_05695) - 1185656..1185925 (-) 270 WP_277375485.1 hypothetical protein -
  NBT14_RS05720 (NBT14_05700) - 1185928..1186323 (-) 396 WP_277375486.1 hypothetical protein -
  NBT14_RS05725 (NBT14_05705) - 1186338..1191125 (-) 4788 WP_404975357.1 phage tail spike protein -
  NBT14_RS05730 (NBT14_05710) - 1191122..1191928 (-) 807 WP_277380224.1 distal tail protein Dit -
  NBT14_RS05735 (NBT14_05715) - 1191947..1195444 (-) 3498 WP_404975358.1 phage tail tape measure protein -
  NBT14_RS05740 (NBT14_05720) - 1195445..1195759 (-) 315 WP_277375490.1 hypothetical protein -
  NBT14_RS05745 (NBT14_05725) - 1195870..1196208 (-) 339 WP_277375491.1 tail assembly chaperone -
  NBT14_RS05750 (NBT14_05730) - 1196332..1196895 (-) 564 WP_277375492.1 phage major tail protein, TP901-1 family -
  NBT14_RS05755 (NBT14_05735) - 1196911..1197306 (-) 396 WP_277375493.1 hypothetical protein -
  NBT14_RS05760 (NBT14_05740) - 1197303..1197677 (-) 375 WP_002828433.1 HK97-gp10 family putative phage morphogenesis protein -
  NBT14_RS05765 (NBT14_05745) - 1197667..1197981 (-) 315 WP_277380228.1 hypothetical protein -
  NBT14_RS05770 (NBT14_05750) - 1197991..1198335 (-) 345 WP_277375496.1 phage head-tail connector protein -
  NBT14_RS05775 (NBT14_05755) - 1198353..1198634 (-) 282 WP_277375497.1 phosphoenolpyruvate synthase -
  NBT14_RS05780 (NBT14_05760) - 1198700..1199527 (-) 828 WP_002828438.1 N4-gp56 family major capsid protein -
  NBT14_RS05785 (NBT14_05765) - 1199531..1200127 (-) 597 WP_277375498.1 DUF4355 domain-containing protein -
  NBT14_RS05790 (NBT14_05770) - 1200295..1201260 (-) 966 WP_404975359.1 minor capsid protein -
  NBT14_RS05795 (NBT14_05775) - 1201250..1202743 (-) 1494 WP_404975360.1 phage portal protein -
  NBT14_RS05800 (NBT14_05780) - 1202754..1204043 (-) 1290 WP_404975361.1 PBSX family phage terminase large subunit -
  NBT14_RS05805 (NBT14_05785) - 1204036..1204542 (-) 507 WP_277380232.1 terminase small subunit -
  NBT14_RS05810 (NBT14_05790) - 1204813..1205385 (-) 573 WP_404975362.1 hypothetical protein -
  NBT14_RS05815 (NBT14_05795) - 1205962..1206168 (-) 207 WP_002828449.1 CsbD family protein -
  NBT14_RS05820 (NBT14_05800) - 1206267..1206512 (-) 246 WP_002828450.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  NBT14_RS05830 (NBT14_05810) - 1206882..1207322 (-) 441 WP_404975363.1 DUF722 domain-containing protein -
  NBT14_RS05835 (NBT14_05815) - 1207506..1209164 (+) 1659 WP_277375504.1 hypothetical protein -
  NBT14_RS05840 (NBT14_05820) - 1209324..1209779 (-) 456 WP_040760818.1 GAF domain-containing protein -
  NBT14_RS05845 (NBT14_05825) pnuC 1209847..1210542 (-) 696 WP_002828454.1 nicotinamide riboside transporter PnuC -
  NBT14_RS05850 (NBT14_05830) - 1210667..1210852 (-) 186 WP_002828455.1 hypothetical protein -
  NBT14_RS05855 (NBT14_05835) - 1210852..1211478 (-) 627 WP_404975364.1 hypothetical protein -
  NBT14_RS05860 (NBT14_05840) - 1211478..1211723 (-) 246 WP_277375507.1 hypothetical protein -
  NBT14_RS05865 (NBT14_05845) - 1211761..1212198 (-) 438 WP_277380235.1 dTDP-glucose pyrophosphorylase -
  NBT14_RS05870 (NBT14_05850) - 1212186..1212356 (-) 171 WP_277375509.1 hypothetical protein -
  NBT14_RS05875 (NBT14_05855) - 1212359..1213084 (-) 726 WP_164223985.1 ATP-binding protein -
  NBT14_RS05880 (NBT14_05860) - 1213071..1213964 (-) 894 WP_404975365.1 phage replisome organizer N-terminal domain-containing protein -
  NBT14_RS05885 (NBT14_05865) ssb 1213973..1214500 (-) 528 WP_164223991.1 single-stranded DNA-binding protein Machinery gene
  NBT14_RS05890 (NBT14_05870) - 1214463..1215173 (-) 711 WP_404975366.1 putative HNHc nuclease -
  NBT14_RS05895 (NBT14_05875) - 1215173..1215814 (-) 642 WP_150191260.1 ERF family protein -
  NBT14_RS05900 (NBT14_05880) - 1215798..1215992 (-) 195 WP_150191261.1 hypothetical protein -
  NBT14_RS05905 (NBT14_05885) - 1216071..1216430 (-) 360 WP_404975367.1 hypothetical protein -
  NBT14_RS05910 (NBT14_05890) - 1216453..1216659 (-) 207 WP_404975368.1 hypothetical protein -
  NBT14_RS05915 (NBT14_05895) - 1216772..1216981 (-) 210 WP_150191264.1 hypothetical protein -
  NBT14_RS05920 (NBT14_05900) - 1216983..1217177 (-) 195 WP_150222728.1 hypothetical protein -
  NBT14_RS05925 (NBT14_05905) - 1217295..1217507 (+) 213 WP_404975370.1 hypothetical protein -
  NBT14_RS05930 (NBT14_05910) - 1217858..1218331 (+) 474 WP_277375520.1 hypothetical protein -
  NBT14_RS05935 (NBT14_05915) - 1218462..1219193 (-) 732 WP_404975371.1 ORF6C domain-containing protein -
  NBT14_RS05940 (NBT14_05920) - 1219206..1219424 (-) 219 WP_141926556.1 helix-turn-helix domain-containing protein -
  NBT14_RS05945 (NBT14_05925) - 1219701..1220051 (+) 351 WP_404975372.1 helix-turn-helix domain-containing protein -
  NBT14_RS05950 (NBT14_05930) - 1220129..1220620 (+) 492 WP_404975373.1 hypothetical protein -
  NBT14_RS05955 (NBT14_05935) - 1220699..1221355 (+) 657 WP_404975374.1 Ltp family lipoprotein -
  NBT14_RS05960 (NBT14_05940) - 1221527..1222603 (+) 1077 WP_404975375.1 tyrosine-type recombinase/integrase -
  NBT14_RS05970 (NBT14_05950) - 1222898..1223404 (-) 507 WP_150177836.1 antibiotic biosynthesis monooxygenase -
  NBT14_RS05975 (NBT14_05955) - 1223498..1224226 (-) 729 WP_002828485.1 CPBP family intramembrane glutamic endopeptidase -
  NBT14_RS05980 (NBT14_05960) - 1224213..1224419 (-) 207 WP_040760843.1 hypothetical protein -
  NBT14_RS05985 (NBT14_05965) - 1224424..1225260 (-) 837 WP_002828487.1 Cof-type HAD-IIB family hydrolase -
  NBT14_RS05990 (NBT14_05970) mscL 1225440..1225832 (+) 393 WP_002828488.1 large conductance mechanosensitive channel protein MscL -
  NBT14_RS05995 (NBT14_05975) - 1226023..1226661 (+) 639 WP_002828489.1 deoxynucleoside kinase -
  NBT14_RS06000 (NBT14_05980) - 1226734..1228158 (-) 1425 WP_277380247.1 C40 family peptidase -

Sequence


Protein


Download         Length: 175 a.a.        Molecular weight: 19569.44 Da        Isoelectric Point: 9.5083

>NTDB_id=695222 NBT14_RS05885 WP_164223991.1 1213973..1214500(-) (ssb) [Weissella paramesenteroides strain LCW-28]
MINNVTLTGRLTKDMELKYTTSGTAVASATVAVERSFTDGNGERGSDFINFVIWRKAAENLAKMTAKGSLIGLEGRLQTR
SYDNQQGQKVFVTEVVVNNFSLLESKEVTDQRKQGGVNQPQQNNFNQQPQRQNNFNQQQAPQGNFNQQRQQPQQNNFGGS
QGYGNGNNFEDQLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=695222 NBT14_RS05885 WP_164223991.1 1213973..1214500(-) (ssb) [Weissella paramesenteroides strain LCW-28]
ATGATAAACAACGTCACACTAACTGGCAGACTAACTAAAGATATGGAGTTGAAATATACCACGTCAGGTACAGCCGTAGC
CAGTGCAACAGTAGCAGTTGAACGTTCATTTACTGACGGTAATGGTGAACGAGGTAGTGACTTTATTAACTTTGTTATTT
GGCGTAAGGCGGCTGAAAATCTAGCTAAAATGACCGCTAAAGGTTCATTGATTGGACTGGAAGGACGACTACAAACACGT
AGTTATGATAACCAGCAAGGACAAAAAGTATTTGTTACTGAAGTTGTCGTTAATAACTTCTCGCTATTAGAAAGCAAGGA
AGTTACTGACCAACGTAAGCAAGGCGGAGTTAATCAACCGCAGCAAAATAACTTTAATCAACAGCCACAGCGACAAAACA
ATTTCAACCAACAGCAAGCACCACAAGGAAACTTCAATCAACAACGCCAACAACCACAGCAAAATAATTTTGGTGGATCA
CAGGGGTATGGCAACGGCAATAACTTTGAAGACCAATTACCATTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

51.934

100

0.537

  ssbA Bacillus subtilis subsp. subtilis str. 168

60.377

60.571

0.366