Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   BVS141_RS02020 Genome accession   NZ_AP018402
Coordinates   401084..401203 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain S141     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 396084..406203
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVS141_RS02005 (BVS141_04030) - 397696..398379 (+) 684 WP_060563078.1 response regulator transcription factor -
  BVS141_RS02010 (BVS141_04040) - 398366..399799 (+) 1434 WP_162262652.1 sensor histidine kinase -
  BVS141_RS02015 (BVS141_04050) rapC 399952..401100 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  BVS141_RS02020 phrC 401084..401203 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  BVS141_RS02025 - 401354..401464 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  BVS141_RS02030 (BVS141_04060) - 401544..402908 (-) 1365 WP_060563080.1 aspartate kinase -
  BVS141_RS02040 (BVS141_04070) ceuB 403324..404277 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  BVS141_RS02045 (BVS141_04080) - 404267..405214 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  BVS141_RS02050 (BVS141_04090) - 405208..405966 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=69482 BVS141_RS02020 WP_003156334.1 401084..401203(+) (phrC) [Bacillus velezensis strain S141]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=69482 BVS141_RS02020 WP_003156334.1 401084..401203(+) (phrC) [Bacillus velezensis strain S141]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment