Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M8561_RS12235 Genome accession   NZ_CP097895
Coordinates   2545389..2545562 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain B1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2540389..2550562
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8561_RS12220 (M8561_12220) gcvT 2541207..2542307 (-) 1101 WP_024085597.1 glycine cleavage system aminomethyltransferase GcvT -
  M8561_RS12225 (M8561_12225) - 2542730..2544400 (+) 1671 WP_003153107.1 SNF2-related protein -
  M8561_RS12230 (M8561_12230) - 2544418..2545212 (+) 795 WP_003153106.1 YqhG family protein -
  M8561_RS12235 (M8561_12235) sinI 2545389..2545562 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  M8561_RS12240 (M8561_12240) sinR 2545596..2545931 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8561_RS12245 (M8561_12245) - 2545979..2546764 (-) 786 WP_015388008.1 TasA family protein -
  M8561_RS12250 (M8561_12250) - 2546828..2547412 (-) 585 WP_003153100.1 signal peptidase I -
  M8561_RS12255 (M8561_12255) tapA 2547384..2548055 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  M8561_RS12260 (M8561_12260) - 2548315..2548644 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  M8561_RS12265 (M8561_12265) - 2548684..2548863 (-) 180 WP_003153093.1 YqzE family protein -
  M8561_RS12270 (M8561_12270) comGG 2548920..2549297 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8561_RS12275 (M8561_12275) comGF 2549298..2549798 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  M8561_RS12280 (M8561_12280) comGE 2549707..2550021 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  M8561_RS12285 (M8561_12285) comGD 2550005..2550442 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=693408 M8561_RS12235 WP_003153105.1 2545389..2545562(+) (sinI) [Bacillus velezensis strain B1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=693408 M8561_RS12235 WP_003153105.1 2545389..2545562(+) (sinI) [Bacillus velezensis strain B1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702