Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   M8561_RS12280 Genome accession   NZ_CP097895
Coordinates   2549707..2550021 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain B1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2544707..2555021
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8561_RS12235 (M8561_12235) sinI 2545389..2545562 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  M8561_RS12240 (M8561_12240) sinR 2545596..2545931 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8561_RS12245 (M8561_12245) - 2545979..2546764 (-) 786 WP_015388008.1 TasA family protein -
  M8561_RS12250 (M8561_12250) - 2546828..2547412 (-) 585 WP_003153100.1 signal peptidase I -
  M8561_RS12255 (M8561_12255) tapA 2547384..2548055 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  M8561_RS12260 (M8561_12260) - 2548315..2548644 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  M8561_RS12265 (M8561_12265) - 2548684..2548863 (-) 180 WP_003153093.1 YqzE family protein -
  M8561_RS12270 (M8561_12270) comGG 2548920..2549297 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8561_RS12275 (M8561_12275) comGF 2549298..2549798 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  M8561_RS12280 (M8561_12280) comGE 2549707..2550021 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  M8561_RS12285 (M8561_12285) comGD 2550005..2550442 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8561_RS12290 (M8561_12290) comGC 2550432..2550740 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  M8561_RS12295 (M8561_12295) comGB 2550745..2551782 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  M8561_RS12300 (M8561_12300) comGA 2551769..2552839 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  M8561_RS12305 (M8561_12305) - 2553031..2553981 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=693411 M8561_RS12280 WP_015388003.1 2549707..2550021(-) (comGE) [Bacillus velezensis strain B1]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=693411 M8561_RS12280 WP_015388003.1 2549707..2550021(-) (comGE) [Bacillus velezensis strain B1]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481