Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MF619_RS15000 Genome accession   NZ_CP097784
Coordinates   2990650..2990790 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain V 3.14     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2985650..2995790
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MF619_RS14970 (MF619_002983) mnhG 2985842..2986216 (+) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  MF619_RS14975 (MF619_002984) - 2986256..2986639 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  MF619_RS14980 (MF619_002985) comA 2986661..2987305 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  MF619_RS14985 (MF619_002986) comP 2987386..2989380 (-) 1995 WP_250236997.1 ATP-binding protein Regulator
  MF619_RS14990 (MF619_002987) comX 2989400..2989570 (-) 171 WP_003152048.1 competence pheromone ComX Regulator
  MF619_RS14995 (MF619_002988) comQ 2989533..2990465 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  MF619_RS15000 (MF619_002989) degQ 2990650..2990790 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  MF619_RS15005 (MF619_002990) - 2991256..2991597 (+) 342 WP_014305721.1 hypothetical protein -
  MF619_RS15010 (MF619_002991) - 2991604..2992824 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  MF619_RS15015 (MF619_002992) - 2992954..2994420 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  MF619_RS15020 (MF619_002993) - 2994438..2994989 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  MF619_RS15025 (MF619_002994) - 2995086..2995484 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=692391 MF619_RS15000 WP_003152043.1 2990650..2990790(-) (degQ) [Bacillus velezensis strain V 3.14]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=692391 MF619_RS15000 WP_003152043.1 2990650..2990790(-) (degQ) [Bacillus velezensis strain V 3.14]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891