Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MF621_RS14370 Genome accession   NZ_CP097779
Coordinates   2920364..2920504 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain R 4.6     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2915364..2925504
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MF621_RS14340 (MF621_002855) mnhG 2915556..2915930 (+) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  MF621_RS14345 (MF621_002856) - 2915970..2916353 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  MF621_RS14350 (MF621_002857) comA 2916375..2917019 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  MF621_RS14355 (MF621_002858) comP 2917100..2919094 (-) 1995 WP_250236997.1 ATP-binding protein Regulator
  MF621_RS14360 (MF621_002859) comX 2919114..2919284 (-) 171 WP_003152048.1 competence pheromone ComX Regulator
  MF621_RS14365 (MF621_002860) comQ 2919247..2920179 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  MF621_RS14370 (MF621_002861) degQ 2920364..2920504 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  MF621_RS14375 (MF621_002862) - 2920970..2921311 (+) 342 WP_014305721.1 hypothetical protein -
  MF621_RS14380 (MF621_002863) - 2921318..2922538 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  MF621_RS14385 (MF621_002864) - 2922668..2924134 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  MF621_RS14390 (MF621_002865) - 2924152..2924703 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  MF621_RS14395 (MF621_002866) - 2924800..2925198 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=692312 MF621_RS14370 WP_003152043.1 2920364..2920504(-) (degQ) [Bacillus velezensis strain R 4.6]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=692312 MF621_RS14370 WP_003152043.1 2920364..2920504(-) (degQ) [Bacillus velezensis strain R 4.6]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891