Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   MF621_RS14360 Genome accession   NZ_CP097779
Coordinates   2919114..2919284 (-) Length   56 a.a.
NCBI ID   WP_003152048.1    Uniprot ID   -
Organism   Bacillus velezensis strain R 4.6     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 2914114..2924284
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MF621_RS14330 (MF621_002853) - 2914812..2915288 (+) 477 WP_003152059.1 Na+/H+ antiporter subunit E -
  MF621_RS14335 (MF621_002854) - 2915288..2915572 (+) 285 WP_003152057.1 Na(+)/H(+) antiporter subunit F1 -
  MF621_RS14340 (MF621_002855) mnhG 2915556..2915930 (+) 375 WP_003152056.1 monovalent cation/H(+) antiporter subunit G -
  MF621_RS14345 (MF621_002856) - 2915970..2916353 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  MF621_RS14350 (MF621_002857) comA 2916375..2917019 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  MF621_RS14355 (MF621_002858) comP 2917100..2919094 (-) 1995 WP_250236997.1 ATP-binding protein Regulator
  MF621_RS14360 (MF621_002859) comX 2919114..2919284 (-) 171 WP_003152048.1 competence pheromone ComX Regulator
  MF621_RS14365 (MF621_002860) comQ 2919247..2920179 (-) 933 WP_025650217.1 class 1 isoprenoid biosynthesis enzyme Regulator
  MF621_RS14370 (MF621_002861) degQ 2920364..2920504 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  MF621_RS14375 (MF621_002862) - 2920970..2921311 (+) 342 WP_014305721.1 hypothetical protein -
  MF621_RS14380 (MF621_002863) - 2921318..2922538 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  MF621_RS14385 (MF621_002864) - 2922668..2924134 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 56 a.a.        Molecular weight: 6574.54 Da        Isoelectric Point: 4.8018

>NTDB_id=692310 MF621_RS14360 WP_003152048.1 2919114..2919284(-) (comX) [Bacillus velezensis strain R 4.6]
MQNLINYFLNYPDVLKKLKSNEASLIGYDSIQTQIIIKGFENYLMMGADNKKWDNE

Nucleotide


Download         Length: 171 bp        

>NTDB_id=692310 MF621_RS14360 WP_003152048.1 2919114..2919284(-) (comX) [Bacillus velezensis strain R 4.6]
ATGCAGAATTTAATAAATTATTTTTTGAATTATCCTGATGTATTAAAGAAACTGAAAAGCAATGAAGCTAGCCTTATCGG
TTATGACTCTATACAAACGCAAATTATCATTAAAGGGTTTGAGAATTATTTAATGATGGGTGCGGACAATAAAAAATGGG
ATAATGAATAA

Domains

Predicted by InterproScan.

Bacillus competence pheromone ComX (ComX)

(1-42)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

52.83

94.643

0.5