Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M8965_RS12805 Genome accession   NZ_CP097602
Coordinates   2514893..2515066 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain UA0244     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2509893..2520066
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8965_RS12790 gcvT 2510707..2511807 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  M8965_RS12795 - 2512230..2513900 (+) 1671 WP_032874031.1 SNF2-related protein -
  M8965_RS12800 - 2513922..2514716 (+) 795 WP_007612541.1 YqhG family protein -
  M8965_RS12805 sinI 2514893..2515066 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  M8965_RS12810 sinR 2515100..2515435 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8965_RS12815 - 2515483..2516268 (-) 786 WP_032874027.1 TasA family protein -
  M8965_RS12820 - 2516333..2516917 (-) 585 WP_032874025.1 signal peptidase I -
  M8965_RS12825 tapA 2516889..2517560 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  M8965_RS12830 - 2517819..2518148 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  M8965_RS12835 - 2518189..2518368 (-) 180 WP_022552966.1 YqzE family protein -
  M8965_RS12840 comGG 2518425..2518802 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8965_RS12845 comGF 2518803..2519303 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  M8965_RS12850 comGE 2519212..2519526 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  M8965_RS12855 comGD 2519510..2519947 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=691019 M8965_RS12805 WP_032874029.1 2514893..2515066(+) (sinI) [Bacillus velezensis strain UA0244]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=691019 M8965_RS12805 WP_032874029.1 2514893..2515066(+) (sinI) [Bacillus velezensis strain UA0244]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719