Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   M8965_RS12850 Genome accession   NZ_CP097602
Coordinates   2519212..2519526 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain UA0244     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2514212..2524526
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8965_RS12805 sinI 2514893..2515066 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  M8965_RS12810 sinR 2515100..2515435 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8965_RS12815 - 2515483..2516268 (-) 786 WP_032874027.1 TasA family protein -
  M8965_RS12820 - 2516333..2516917 (-) 585 WP_032874025.1 signal peptidase I -
  M8965_RS12825 tapA 2516889..2517560 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  M8965_RS12830 - 2517819..2518148 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  M8965_RS12835 - 2518189..2518368 (-) 180 WP_022552966.1 YqzE family protein -
  M8965_RS12840 comGG 2518425..2518802 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8965_RS12845 comGF 2518803..2519303 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  M8965_RS12850 comGE 2519212..2519526 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  M8965_RS12855 comGD 2519510..2519947 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8965_RS12860 comGC 2519937..2520203 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  M8965_RS12865 comGB 2520250..2521287 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  M8965_RS12870 comGA 2521274..2522344 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  M8965_RS12875 - 2522541..2523491 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=691022 M8965_RS12850 WP_032874016.1 2519212..2519526(-) (comGE) [Bacillus velezensis strain UA0244]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=691022 M8965_RS12850 WP_032874016.1 2519212..2519526(-) (comGE) [Bacillus velezensis strain UA0244]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481