Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M8968_RS09925 Genome accession   NZ_CP097594
Coordinates   1918530..1918703 (-) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain UA0182     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1913530..1923703
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M8968_RS09875 comGD 1913649..1914086 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  M8968_RS09880 comGE 1914070..1914384 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  M8968_RS09885 comGF 1914293..1914793 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  M8968_RS09890 comGG 1914794..1915171 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  M8968_RS09895 - 1915228..1915407 (+) 180 WP_022552966.1 YqzE family protein -
  M8968_RS09900 - 1915448..1915777 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  M8968_RS09905 tapA 1916036..1916707 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  M8968_RS09910 - 1916679..1917263 (+) 585 WP_032874025.1 signal peptidase I -
  M8968_RS09915 - 1917328..1918113 (+) 786 WP_032874027.1 TasA family protein -
  M8968_RS09920 sinR 1918161..1918496 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M8968_RS09925 sinI 1918530..1918703 (-) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  M8968_RS09930 - 1918880..1919674 (-) 795 WP_007612541.1 YqhG family protein -
  M8968_RS09935 - 1919696..1921366 (-) 1671 WP_032874031.1 SNF2-related protein -
  M8968_RS09940 gcvT 1921789..1922889 (+) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=690945 M8968_RS09925 WP_032874029.1 1918530..1918703(-) (sinI) [Bacillus velezensis strain UA0182]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=690945 M8968_RS09925 WP_032874029.1 1918530..1918703(-) (sinI) [Bacillus velezensis strain UA0182]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719